FC869311

Overview
NameFC869311
Unique NameFC869311
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length738
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14114 contig Ccv1_Contig14114:1..732. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869311 vs. ExPASy Swiss-Prot
Match: ALFC_SPIOL (Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3)

HSP 1 Score: 308.145 bits (788), Expect = 3.091e-83
Identity = 155/181 (85.64%), Postives = 165/181 (91.16%), Query Frame = 2
Query:  152 PVLDKSEWVKGQAIR-QSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 691
            PVLD  E++KGQ +R  S   VR  PSG SSLT+RA SYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLL++APGLGQY+SGAILFEETLYQSTTDGKKMVDVL+EQ IVPGIKVDKG +PL GSNDESWCQGLDGLA R+AAYYQQGARFAKWRTVVSIP
Sbjct:   11 PVLDNPEFLKGQTLRIPSVAGVRFTPSGSSSLTVRASSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLISAPGLGQYVSGAILFEETLYQSTTDGKKMVDVLIEQGIVPGIKVDKGWLPLPGSNDESWCQGLDGLACRSAAYYQQGARFAKWRTVVSIP 191          
BLAST of FC869311 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2)

HSP 1 Score: 298.516 bits (763), Expect = 2.449e-80
Identity = 154/180 (85.56%), Postives = 164/180 (91.11%), Query Frame = 2
Query:  164 KSEWVKGQAI---RQSTVSVRSLPSGPSSLTIRAGS-YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 691
            KS+WVKGQ++   + S+VS       PS+LT+RA S YADELVKTAKT+ASPG GI+AMDESNATCGKRLASIGLENTEANRQAYRTLLV+APGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPL GS DESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP
Sbjct:   15 KSDWVKGQSLLLRQPSSVSAIRSHVAPSALTVRAASAYADELVKTAKTIASPGHGIMAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLVGSYDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 194          
BLAST of FC869311 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 4.177e-80
Identity = 154/183 (84.15%), Postives = 168/183 (91.80%), Query Frame = 2
Query:  152 PVLDKSEWVKGQAI--RQSTVSVRSLPSGPSSLTIRAGS-YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 691
            PVLDKSEWVKGQ++  RQ + +   L +  +SLT+RA S YADELVKTAKT+ASPGRGILAMDESNATCGKRL SIGLENTEANRQA+RTLLV+APGLGQY+SGAILFEETLYQSTT+GKKMVDVLVEQNIVPGIKVDKGLVPL GSN+ESW QGLDGL+SRTAAYYQQGARFAKWRTVVSIP
Sbjct:   11 PVLDKSEWVKGQSVLFRQPSSASVVLRNRATSLTVRAASSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLVSAPGLGQYVSGAILFEETLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWGQGLDGLSSRTAAYYQQGARFAKWRTVVSIP 193          
BLAST of FC869311 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 1.391e-75
Identity = 139/150 (92.67%), Postives = 147/150 (98.00%), Query Frame = 2
Query:  242 LTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 691
            LTIRAGSYADELVKTAKT+ASPGRGILAMDESNATCGKRLASIGLENTE NRQA+RTLLVT P LG+YISGAILFEETLYQSTTDG+K+VDVL+EQNI+PGIKVDKGLVPLAGSNDESWCQGLDGLASR+AAYYQQGARFAKWRTVVSIP
Sbjct:    2 LTIRAGSYADELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEVNRQAWRTLLVTVPTLGEYISGAILFEETLYQSTTDGRKIVDVLIEQNIIPGIKVDKGLVPLAGSNDESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIP 151          
BLAST of FC869311 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 2.372e-75
Identity = 146/177 (82.49%), Postives = 154/177 (87.01%), Query Frame = 2
Query:  164 KSEW-VKGQAIRQSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 691
            KSEW    QA     V+V        S+ +RAG+Y DELVKTAKT+ASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQST DGKK+VD+L EQ IVPGIKVDKGLVPLAGSN+ESWCQGLDGLASR AAYYQQGARFAKWRTVVSIP
Sbjct:   15 KSEWGATRQAAAPKPVTV--------SMVVRAGAYDDELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGKKIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVVSIP 183          
BLAST of FC869311 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 270.011 bits (689), Expect = 9.327e-72
Identity = 133/145 (91.72%), Postives = 141/145 (97.24%), Query Frame = 2
Query:  257 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 691
            GSYADELVKTAKT+ASPGRGILAMDESNATCGKRL SIGLENTEANRQA+RTLLVT P LG+YISGAILFEETLYQST DG+K+VDVLVEQNI+PGIKVDKGLVPLAGSN+ESWCQGLDGLASR+AAYYQQGARFAKWRTVVSIP
Sbjct:    1 GSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAWRTLLVTVPTLGEYISGAILFEETLYQSTVDGRKIVDVLVEQNIIPGIKVDKGLVPLAGSNNESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIP 145          
BLAST of FC869311 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 2.887e-68
Identity = 129/175 (73.71%), Postives = 147/175 (84.00%), Query Frame = 2
Query:  167 SEWVKGQAIRQSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 691
            S W+  ++   ++ S  S P    S  IRAG+Y+DELVKTAK++ASPGRGILA+DESNATCGKRLASIGL+NTE NRQAYR LL+T PGLG YISG+ILFEETLYQST DGK  VD L + NIVPGIKVDKGL PLAGSN+ESWCQGLDGLASR+A YY+QGARFAKWRTVVS+P
Sbjct:   14 SPWIGQRSFAHTSAS--SSPPPRVSFAIRAGAYSDELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLTTPGLGDYISGSILFEETLYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLDGLASRSAEYYKQGARFAKWRTVVSVP 186          

HSP 2 Score: 22.7126 bits (47), Expect = 2.887e-68
Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 1
Query:  694 GPSALAVKEA 723
            GPSALAVKEA
Sbjct:  188 GPSALAVKEA 197          
BLAST of FC869311 vs. ExPASy Swiss-Prot
Match: ALFC_CHLRE (Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 9.371e-56
Identity = 113/145 (77.93%), Postives = 121/145 (83.45%), Query Frame = 2
Query:  257 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 691
            G Y +EL+KTA TVAS GRGILAMDESNATCGKRL SIG+ENTE NR+AYR LLVTAPGLGQYISGAILFEETLYQST  GKK VDV+ EQNIVPGIKVDKGLVP   +   SWC GLDG  S  A YY+ GARFAKWR+VVSIP
Sbjct:   28 GKYDEELIKTAGTVASKGRGILAMDESNATCGKRLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEETLYQSTASGKKFVDVMKEQNIVPGIKVDKGLVP-CPTPTMSWCMGLDGWTS-AAEYYKAGARFAKWRSVVSIP 170          
BLAST of FC869311 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 3.946e-46
Identity = 91/142 (64.08%), Postives = 107/142 (75.35%), Query Frame = 2
Query:  263 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 688
            Y DEL+KTAK +A+PGRGILA DES  T GKR A I +ENTE+NRQAYR LL T+PG    +SG ILFEETLYQ T+DGK  VD+L+E  ++PGIKVDKGLV LAG+N E+  QGLD L +R   YY+ GARFAKWR    I
Sbjct:    8 YEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKI 149          
BLAST of FC869311 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.791e-46
Identity = 89/144 (61.81%), Postives = 110/144 (76.39%), Query Frame = 2
Query:  257 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 688
            G YADEL+K AK +A+PG+GILA DES  T GKRLASI +EN EANRQA R LL T+P   QY+SG ILFEETLYQ +++GK  V++L E N++PGIKVDKG+V LAG++ E+  QG D L +R   YY+ GARFAKWR V+ I
Sbjct:    6 GKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKI 149          
The following BLAST results are available for this feature:
BLAST of FC869311 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALFC_SPIOL3.091e-8385.64Fructose-bisphosphate aldolase, chloroplastic OS=S... [more]
ALFC1_ARATH2.449e-8085.56Probable fructose-bisphosphate aldolase 1, chlorop... [more]
ALFC2_ARATH4.177e-8084.15Probable fructose-bisphosphate aldolase 2, chlorop... [more]
ALFC1_PEA1.391e-7592.67Fructose-bisphosphate aldolase 1, chloroplastic (F... [more]
ALFC_ORYSJ2.372e-7582.49Fructose-bisphosphate aldolase, chloroplastic OS=O... [more]
ALFC2_PEA9.327e-7291.72Fructose-bisphosphate aldolase 2, chloroplastic OS... [more]
ALFC3_ARATH2.887e-6873.71Probable fructose-bisphosphate aldolase 3, chlorop... [more]
ALFC_CHLRE9.371e-5677.93Fructose-bisphosphate aldolase 1, chloroplastic OS... [more]
ALF_ARATH3.946e-4664.08Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA8.791e-4661.81Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31010H02EF AbioticL1 Citrus clementina cDNA clone C31010H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869311 ID=FC869311|Name=FC869311|organism=Citrus clementina|type=EST|length=738bp
CCTGGGCCGGGAAAAAAGAGGCAGAAGAAAGTCAGTGAAGATAAGATTAT
AGGTGCTATAAGCTAAGGCCTCTCGAGCTCAGAACCCACAGCAAGAAGAA
GCAAAGAGGAAAATGGCCTCAGCCTCGGCATCTTTACTCAAGTCATCATC
CCCCGTTCTTGACAAGTCTGAGTGGGTTAAGGGCCAGGCCATCCGCCAGT
CTACTGTCTCAGTCCGCAGCCTCCCCAGTGGCCCCTCTTCCCTCACCATC
CGTGCTGGTTCCTATGCCGATGAGCTTGTCAAGACCGCGAAAACTGTTGC
ATCACCAGGACGTGGAATTTTGGCCATGGATGAGTCAAATGCAACTTGTG
GAAAACGCCTTGCCTCAATTGGGTTAGAGAACACTGAGGCTAACCGCCAG
GCATACCGTACCCTCCTTGTTACAGCCCCTGGTCTTGGACAGTACATCTC
TGGTGCCATCCTTTTTGAGGAGACTCTCTACCAATCCACCACCGATGGCA
AGAAGATGGTCGATGTTCTTGTTGAGCAAAACATTGTCCCCGGTATCAAA
GTCGACAAGGGTTTGGTGCCCCTTGCTGGTTCCAATGATGAGTCATGGTG
CCAGGGTCTTGATGGCCTGGCTTCTCGCACTGCTGCTTACTACCAACAGG
GAGCTCGTTTCGCCAAATGGCGTACTGTTGTGAGCATTCCAATGGCCCAT
CTGCCTTGGCAGTCAAGGAAGCGCCTGGGGTCTGCCCG
back to top