FC872950

Overview
NameFC872950
Unique NameFC872950
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1284 contig Ccv1_Contig1284:1..699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC872950 vs. ExPASy Swiss-Prot
Match: NHP2_ARATH (H/ACA ribonucleoprotein complex subunit 2-like protein OS=Arabidopsis thaliana GN=At5g08180 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 105/148 (70.95%), Postives = 122/148 (82.43%), Query Frame = 3
Query:   81 ERTPHKYEKKNIVSLAPIAKPLAGKKLSKGTLGLVRLAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKELASSL 524
            E++  K +KK  ++LAPIAKPLAGKKL K T  L++ AA  KCLKRGVKEVVKSIRRG KGLCVIAGNISPIDVITH+PILCEE+ +PY+YV SKEDLA AGATKRPTCCVLV+ KP KG+L  EE  KLK DY  V +D+KELA+S+
Sbjct:    8 EKSIQKEKKKYAITLAPIAKPLAGKKLQKRTFKLIQKAAGKKCLKRGVKEVVKSIRRGQKGLCVIAGNISPIDVITHLPILCEEAGVPYVYVPSKEDLAQAGATKRPTCCVLVMLKPAKGDLTAEELAKLKTDYEQVSDDIKELATSV 155          
BLAST of FC872950 vs. ExPASy Swiss-Prot
Match: NHP2_YEAST (H/ACA ribonucleoprotein complex subunit 2 OS=Saccharomyces cerevisiae GN=NHP2 PE=1 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 1.734e-32
Identity = 69/143 (48.25%), Postives = 103/143 (72.03%), Query Frame = 3
Query:   84 RTPHKYEKKNIVSLAPIAKPLAGKKLSKGTLGLVRLAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKEL 512
            +T   YE + + ++ P AKPLA KKL+K  L  V+ A++ K +KRGVKEVVK++R+G KGL VIAG+ISP DVI+H+P+LCE+  +PYI++ SK+DL  AGATKRPT  V ++    K + G+ ++++ K  +  VV++V+ L
Sbjct:   15 KTVDNYEAR-MPAVLPFAKPLASKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL 156          
BLAST of FC872950 vs. ExPASy Swiss-Prot
Match: NHP2_SCHPO (H/ACA ribonucleoprotein complex subunit 2 OS=Schizosaccharomyces pombe GN=nhp2 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.052e-29
Identity = 62/131 (47.33%), Postives = 95/131 (72.52%), Query Frame = 3
Query:  120 SLAPIAKPLAGKKLSKGTLGLVRLAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKEL 512
            +L PIAKPLA KKL+K  +  V+ A++ K + RGVKEVVK++R+G KGL ++AG+ISP+DVI+H+P+LCE++++PY+Y  SKE L  A  TKRPT CV+++    K ++ + E+   K  Y  ++++V  L
Sbjct:   24 ALMPIAKPLAPKKLNKKMMKTVKKASKQKHILRGVKEVVKAVRKGEKGLVILAGDISPMDVISHIPVLCEDNNVPYLYTVSKELLGEASNTKRPTSCVMIVPGGKKKDMSKVEE--YKESYEEIIKEVPAL 152          
BLAST of FC872950 vs. ExPASy Swiss-Prot
Match: NHP2_XENTR (H/ACA ribonucleoprotein complex subunit 2-like protein OS=Xenopus tropicalis GN=nhp2 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.682e-25
Identity = 60/126 (47.62%), Postives = 83/126 (65.87%), Query Frame = 3
Query:   42 ITEQIKWEATA*PERTPHKYEKKNIVSLAPIAKPLAGKKLSKGTLGLVRLAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLV 419
            +T+  K E+   PE TP K   + +  L PIAKPLAG+KL+K     V+ A + K ++RGVKEV K I +G KG+ V+AG+  PI+V  H+P++CE+  IPY YV SK DL  A  +KRPTC +L+
Sbjct:    1 MTKAKKEESEEVPE-TPSKSYDELLAYLNPIAKPLAGRKLTKKLYKCVKKAIKQKNIRRGVKEVQKFINKGEKGIVVMAGDTLPIEVYCHIPVMCEDRGIPYSYVPSKSDLGAAAGSKRPTCVILI 125          
BLAST of FC872950 vs. ExPASy Swiss-Prot
Match: NHP2_XENLA (H/ACA ribonucleoprotein complex subunit 2-like protein OS=Xenopus laevis GN=nhp2 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.019e-24
Identity = 59/126 (46.83%), Postives = 82/126 (65.08%), Query Frame = 3
Query:   42 ITEQIKWEATA*PERTPHKYEKKNIVSLAPIAKPLAGKKLSKGTLGLVRLAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLV 419
            +T+  K E    PE TP K   + +  L P+AKPLAG+KL+K     V+ A + K ++RGVKEV K I +G KG+ V+AG+  PI+V  H+P++CE+  IPY YV SK DL  A  +KRPTC +L+
Sbjct:    1 MTKVKKEECEEVPE-TPSKSYDELLSYLNPVAKPLAGRKLTKKLYKCVKKAIKQKNIRRGVKEVQKFINKGEKGIVVMAGDTLPIEVYCHIPVMCEDRGIPYSYVPSKSDLGAAAGSKRPTCVILI 125          
BLAST of FC872950 vs. ExPASy Swiss-Prot
Match: NHP2_MOUSE (H/ACA ribonucleoprotein complex subunit 2 OS=Mus musculus GN=Nhp2 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.510e-23
Identity = 54/121 (44.63%), Postives = 83/121 (68.60%), Query Frame = 3
Query:  105 KKNIVSLAPIAKPLAGKKLSKGTLGLVRLAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDK 467
            K+ +V+L PIA+PLA ++L++     ++ A + K ++RGVKEV K + +G KG+ V+AG+  PI+V  H+P+LCE+ ++PY+Y+ SK DL  A  +KRPTC ++V  KP   E  QE  DK
Sbjct:   25 KELLVNLNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVLCEDQNLPYVYIPSKTDLGAATGSKRPTCVIMV--KP--HEEYQETYDK 141          
BLAST of FC872950 vs. ExPASy Swiss-Prot
Match: NHP2_BOVIN (H/ACA ribonucleoprotein complex subunit 2 OS=Bos taurus GN=NHP2 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.510e-23
Identity = 50/113 (44.25%), Postives = 79/113 (69.91%), Query Frame = 3
Query:   81 ERTPHKYEKKNIVSLAPIAKPLAGKKLSKGTLGLVRLAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLV 419
            ERT H+     +V+L PIA+PLA ++L++     ++ A + K ++RGVKEV K I +G KG+ V+AG+  PI+V  H+P++CE+ ++PY+Y+ SK DL  A  +KRPTC ++V
Sbjct:   21 ERTYHEL----LVNLNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFINKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMV 129          
BLAST of FC872950 vs. ExPASy Swiss-Prot
Match: NHP2_DANRE (H/ACA ribonucleoprotein complex subunit 2-like protein OS=Danio rerio GN=nhp2 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.279e-23
Identity = 59/133 (44.36%), Postives = 81/133 (60.90%), Query Frame = 3
Query:  114 IVSLAPIAKPLAGKKLSKGTLGLVRLAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYTLVVEDVKEL 512
            I ++ PIA PLA +KLSK     V+ AA+ K ++RGVKEV K I +G  G+ V AG+  PIDV  H+PI+CE+  +PY YV SK DL ++  +KRPTC +++  KP          D+ K  Y   VE+V  L
Sbjct:   25 IANINPIANPLASRKLSKKLYKCVKKAAKVKQIRRGVKEVQKFINKGETGIVVFAGDTLPIDVYCHLPIMCEDRSLPYAYVPSKVDLGSSAGSKRPTCVIMI--KP---------HDEYKEAYDECVEEVTSL 146          
BLAST of FC872950 vs. ExPASy Swiss-Prot
Match: NHP2_BRABE (H/ACA ribonucleoprotein complex subunit 2-like protein OS=Branchiostoma belcheri PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.282e-23
Identity = 52/119 (43.70%), Postives = 81/119 (68.07%), Query Frame = 3
Query:  129 PIAKPLAGKKLSKGTLGLVRLAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPTKGELGQEEQDKLKADYT 485
            PIA PLA +KL+K     V+ A++ K +++G+++V K I++G +G+ +IAG+ +PI+V  H+P++CE++ IPY YV +K+DL  A  +KRPTCCVL+  KP   E  Q   D+   D T
Sbjct:   39 PIASPLAARKLTKRLYKTVKKASKEKNIRKGIRDVQKFIKKGERGIVLIAGDTTPIEVYCHLPVVCEDAKIPYCYVPAKQDLGEAAGSKRPTCCVLL--KP--NESYQSSYDECLTDVT 153          
BLAST of FC872950 vs. ExPASy Swiss-Prot
Match: NHP2_CAEBR (Putative H/ACA ribonucleoprotein complex subunit 2-like protein OS=Caenorhabditis briggsae GN=CBG18231 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.246e-22
Identity = 52/118 (44.07%), Postives = 80/118 (67.80%), Query Frame = 3
Query:   87 TPHKYEKKNIVSLA-PIAKPLAGKKLSKGTLGLVRLAAE-HKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVASKEDLANAGATKRPTCCVLVLTKPT 434
            T  K E + +  L  PIA+PLA +KL+K    L++ AA   K L+ G+K+V K +R+  KG+C++AGN+SPIDV +H+P +CEE +IPY+Y+ S+E L  A   +RP+  +L+  KP+
Sbjct:   26 TTEKDEYQALCELVNPIAQPLANRKLAKKVYKLIKKAAAGEKTLREGIKDVQKELRKNEKGICILAGNVSPIDVYSHIPAICEEKEIPYVYIPSREQLGLAVGHRRPS--ILIFVKPS 141          
The following BLAST results are available for this feature:
BLAST of FC872950 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
NHP2_ARATH3.591e-5470.95H/ACA ribonucleoprotein complex subunit 2-like pro... [more]
NHP2_YEAST1.734e-3248.25H/ACA ribonucleoprotein complex subunit 2 OS=Sacch... [more]
NHP2_SCHPO1.052e-2947.33H/ACA ribonucleoprotein complex subunit 2 OS=Schiz... [more]
NHP2_XENTR2.682e-2547.62H/ACA ribonucleoprotein complex subunit 2-like pro... [more]
NHP2_XENLA1.019e-2446.83H/ACA ribonucleoprotein complex subunit 2-like pro... [more]
NHP2_MOUSE2.510e-2344.63H/ACA ribonucleoprotein complex subunit 2 OS=Mus m... [more]
NHP2_BOVIN2.510e-2344.25H/ACA ribonucleoprotein complex subunit 2 OS=Bos t... [more]
NHP2_DANRE3.279e-2344.36H/ACA ribonucleoprotein complex subunit 2-like pro... [more]
NHP2_BRABE4.282e-2343.70H/ACA ribonucleoprotein complex subunit 2-like pro... [more]
NHP2_CAEBR1.246e-2244.07Putative H/ACA ribonucleoprotein complex subunit 2... [more]

Pages

back to top
Libraries
Library NameType
AbsDevcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAI3DG01FM1 AbsDev Citrus clementina cDNA clone KN0AAI3DG01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC872950 ID=FC872950|Name=FC872950|organism=Citrus clementina|type=EST|length=700bp
TGAAAAATAAAACTCAAATCTCTGTTTCGTGCGATTCATTGATAACTGAA
CAAATAAAATGGGAAGCGACAGCTTAACCAGAGAGAACCCCTCATAAATA
TGAGAAGAAGAACATTGTTAGTCTTGCTCCCATTGCTAAGCCTCTAGCTG
GAAAGAAGCTCTCCAAAGGAACCCTCGGGCTTGTCCGTCTAGCTGCTGAG
CACAAATGCTTGAAGAGAGGAGTGAAGGAAGTGGTCAAAAGTATCCGCCG
TGGTCATAAAGGATTATGTGTTATAGCTGGGAACATTAGTCCAATTGATG
TCATCACTCACGTTCCTATCTTATGTGAAGAGTCTGATATTCCCTACATT
TATGTTGCTTCAAAAGAGGATCTTGCAAATGCAGGTGCCACAAAGAGGCC
AACATGCTGTGTTTTGGTGCTAACTAAGCCAACTAAGGGAGAACTAGGAC
AAGAGGAACAAGATAAGTTGAAAGCTGATTATACCCTCGTTGTAGAGGAT
GTGAAGGAACTGGCATCCTCTCTTTTCTGATGAACTAGACTTAAAGCCAA
CAAAGATGATTGTGCTTACAGATATGTTTGATTTCGAACCTTCCCTTTCT
AGCTGAGTAATGTACTCTAGTTTTGTCGAATGTAAAATGCAGTTTGCCTC
TGTTGCATGAGATGGTTGGTTTTCATGTCTCATATGTGGGTATATTGCTT
back to top