FC872958

Overview
NameFC872958
Unique NameFC872958
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length678
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1062 contig Ccv1_Contig1062:60..736. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC872958 vs. ExPASy Swiss-Prot
Match: GPX1_ARATH (Phospholipid hydroperoxide glutathione peroxidase 1, chloroplastic OS=Arabidopsis thaliana GN=GPX1 PE=1 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 1.925e-65
Identity = 116/160 (72.50%), Postives = 129/160 (80.62%), Query Frame = 2
Query:  149 SIKASIGSAKPGLLQHGLFSQSSNLPGFFVKRRSFGAHATAATEKSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQLLKSKCWG 628
            S+K S G +    L +G   +S   PGF  K R F   A AA EK+++DFTVKDIDGKDV L+KFKGKV+LIVNVASRCGLT SNYSELSHLYEKYKTQGFEILAFPCNQFG QEPGSN EIK+FACTRFKAEFPIFDKVDVNGP+TAP+Y+ LKS   G
Sbjct:   33 SLKFSTGISNFANLSNGFSLKSPINPGFLFKSRPFTVQARAAAEKTVHDFTVKDIDGKDVALNKFKGKVMLIVNVASRCGLTSSNYSELSHLYEKYKTQGFEILAFPCNQFGFQEPGSNSEIKQFACTRFKAEFPIFDKVDVNGPSTAPIYEFLKSNAGG 192          

HSP 2 Score: 35.8094 bits (81), Expect = 1.925e-65
Identity = 14/18 (77.78%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  618 SAGGILGDLVKWNFEKFL 671
            +AGG LG L+KWNFEKFL
Sbjct:  189 NAGGFLGGLIKWNFEKFL 206          
BLAST of FC872958 vs. ExPASy Swiss-Prot
Match: GPX7_ARATH (Putative glutathione peroxidase 7, chloroplastic OS=Arabidopsis thaliana GN=GPX7 PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.156e-60
Identity = 117/176 (66.48%), Postives = 136/176 (77.27%), Query Frame = 2
Query:  149 SIKASIGSAKPGLLQHGLFSQSSNLPGFFVKRRSFGAHATAATEKSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQLLKSKCWGNFRRPCQVEL*EVLKW 676
            S++ S  ++K     +G+  +SSN   F VK ++F  +A AA EKS++DFTVKDIDG DV L KFKGK LLIVNVASRCGLT SNYSELS LYEKYK QGFEILAFPCNQFGGQEPGSNPEIK+FACTRFKAEFPIFDKVDVNGP+TAP+Y+ LKS   G         L +++KW
Sbjct:   30 SLRFSTRTSKTRNPSNGVSVKSSNSHRFLVKSKNFSVYARAAAEKSVHDFTVKDIDGNDVSLDKFKGKPLLIVNVASRCGLTSSNYSELSQLYEKYKNQGFEILAFPCNQFGGQEPGSNPEIKQFACTRFKAEFPIFDKVDVNGPSTAPIYKFLKSNAGG--------FLGDIIKW 197          
BLAST of FC872958 vs. ExPASy Swiss-Prot
Match: GPX1_PEA (Phospholipid hydroperoxide glutathione peroxidase, chloroplastic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.915e-57
Identity = 116/175 (66.29%), Postives = 131/175 (74.86%), Query Frame = 2
Query:  155 KASIGSAKPGLLQHGLFSQ-SSNLPGFFVKRRSFGAHATAATEKSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQLLKSKCWGNFRRPCQVEL*EVLKW 676
            K+SI S+K    Q G   Q SSN P    K RSF  +A A  +K++YDFTVKDID KDV LSKFKGKVLLIVNVASRCGLT SNY+ELSHLYE +K +G E+LAFPCNQFG QEPGSN EIK+FACT+FKAEFPIFDKVDVNGP TAPVYQ LKS   G F         +++KW
Sbjct:   34 KSSIASSKSPFFQLGFSQQASSNFPIVPSKTRSFSVNAKAIKDKTIYDFTVKDIDKKDVSLSKFKGKVLLIVNVASRCGLTSSNYTELSHLYENFKNKGLEVLAFPCNQFGMQEPGSNEEIKQFACTKFKAEFPIFDKVDVNGPFTAPVYQFLKSSSGGFFG--------DIVKW 200          
BLAST of FC872958 vs. ExPASy Swiss-Prot
Match: GPX6_ARATH (Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial OS=Arabidopsis thaliana GN=GPX6 PE=2 SV=2)

HSP 1 Score: 190.66 bits (483), Expect = 2.184e-51
Identity = 101/164 (61.59%), Postives = 117/164 (71.34%), Query Frame = 2
Query:  143 TNSIKASIGSAKPGLLQHGLFSQSSNLPGFFVKRRSFGAHATAATEKSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQLLKSKCWGNF 634
            ++S      SAKP    H + S   +  G  + R S  + A ++  KSLYDFTVKD  G DV LS +KGKVLLIVNVAS+CGLT SNY+EL+ LYEKYK  GFEILAFPCNQFG QEPG+N EI +FACTRFKAE+PIFDKVDVNG   APVY+ LKS   G F
Sbjct:   26 SSSSSKRFDSAKPLFNSHRIISLPISTTGAKLSR-SEHSMAASSEPKSLYDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELAQLYEKYKGHGFEILAFPCNQFGNQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDKAAPVYKFLKSSKGGLF 188          

HSP 2 Score: 31.5722 bits (70), Expect = 2.184e-51
Identity = 12/18 (66.67%), Postives = 14/18 (77.78%), Query Frame = 3
Query:  618 SAGGILGDLVKWNFEKFL 671
            S GG+ GD +KWNF KFL
Sbjct:  183 SKGGLFGDGIKWNFAKFL 200          
BLAST of FC872958 vs. ExPASy Swiss-Prot
Match: GPX4_CITSI (Probable phospholipid hydroperoxide glutathione peroxidase OS=Citrus sinensis GN=CSA PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 7.478e-49
Identity = 87/120 (72.50%), Postives = 101/120 (84.17%), Query Frame = 2
Query:  275 TEKSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQLLKSKCWGNF 634
            ++ S++DFTVKD  G+DV LS +KGK+LLIVNVAS+CGLT SNY+ELS LY+KYK QG EILAFPCNQFG QEPG N +I+EFACTRFKAEFPIFDKVDVNG N AP+Y+ LKS   G F
Sbjct:    5 SKTSVHDFTVKDAKGQDVDLSIYKGKLLLIVNVASQCGLTNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLF 124          

HSP 2 Score: 32.7278 bits (73), Expect = 7.478e-49
Identity = 12/18 (66.67%), Postives = 14/18 (77.78%), Query Frame = 3
Query:  618 SAGGILGDLVKWNFEKFL 671
            S GG+ GD +KWNF KFL
Sbjct:  119 SKGGLFGDSIKWNFSKFL 136          
BLAST of FC872958 vs. ExPASy Swiss-Prot
Match: GPX4_SPIOL (Probable phospholipid hydroperoxide glutathione peroxidase OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 3.977e-47
Identity = 85/126 (67.46%), Postives = 101/126 (80.16%), Query Frame = 2
Query:  257 AHATAATEKSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQLLKSKCWGNF 634
            A  ++A  KS+++F V+D  G DV LS +KGKVLLIVNVAS+CGLT SNY+E++ LYEKY+  G EILAFPCNQFG QEPGSN E+ EFACTRFKAE+PIFDKVDVNG N AP+Y+ LKS   G F
Sbjct:    2 ASDSSAQPKSVHEFVVRDARGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTEMTELYEKYRELGLEILAFPCNQFGNQEPGSNEEVLEFACTRFKAEYPIFDKVDVNGSNAAPIYKFLKSSKGGLF 127          

HSP 2 Score: 30.8018 bits (68), Expect = 3.977e-47
Identity = 12/18 (66.67%), Postives = 14/18 (77.78%), Query Frame = 3
Query:  618 SAGGILGDLVKWNFEKFL 671
            S GG+ GD +KWNF KFL
Sbjct:  122 SKGGLFGDGLKWNFTKFL 139          
BLAST of FC872958 vs. ExPASy Swiss-Prot
Match: GPX4_NICSY (Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 6.758e-47
Identity = 83/118 (70.34%), Postives = 97/118 (82.20%), Query Frame = 2
Query:  281 KSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQLLKSKCWGNF 634
            +S+YDFTVKD  G DV LS +KGKVL+IVNVAS+CGLT SNY++L+ +Y+KYK QG EILAFPCNQFGGQEPGS  EI+   CTRFKAE+PIFDKVDVNG N AP+Y+ LKS   G F
Sbjct:    9 QSIYDFTVKDAKGNDVDLSIYKGKVLIIVNVASQCGLTNSNYTDLTEIYKKYKDQGLEILAFPCNQFGGQEPGSIEEIQNMVCTRFKAEYPIFDKVDVNGDNAAPLYKFLKSSKGGFF 126          

HSP 2 Score: 31.9574 bits (71), Expect = 6.758e-47
Identity = 12/18 (66.67%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  618 SAGGILGDLVKWNFEKFL 671
            S GG  GD +KWNF KFL
Sbjct:  121 SKGGFFGDSIKWNFSKFL 138          
BLAST of FC872958 vs. ExPASy Swiss-Prot
Match: GPX4_SOLLC (Probable phospholipid hydroperoxide glutathione peroxidase OS=Solanum lycopersicum GN=GPXle-1 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.148e-46
Identity = 82/118 (69.49%), Postives = 99/118 (83.90%), Query Frame = 2
Query:  281 KSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQLLKSKCWGNF 634
            +S+YDFTVKD  GKDV LS +KGKVL+IVNVAS+CGLT SNY++++ LY+KYK QG EILAFPCNQFGGQEPG+  +I++  CTRFKAE+PIFDKVDVNG N AP+Y+ LKS   G F
Sbjct:    9 QSVYDFTVKDAKGKDVDLSIYKGKVLIIVNVASQCGLTNSNYTDMTELYKKYKDQGLEILAFPCNQFGGQEPGNIEDIQQMVCTRFKAEYPIFDKVDVNGDNAAPLYRFLKSSKGGFF 126          

HSP 2 Score: 31.187 bits (69), Expect = 1.148e-46
Identity = 12/18 (66.67%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  618 SAGGILGDLVKWNFEKFL 671
            S GG  GD +KWNF KFL
Sbjct:  121 SKGGFFGDGIKWNFSKFL 138          
BLAST of FC872958 vs. ExPASy Swiss-Prot
Match: GPX4_TOBAC (Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.148e-46
Identity = 82/118 (69.49%), Postives = 97/118 (82.20%), Query Frame = 2
Query:  281 KSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQLLKSKCWGNF 634
            +S+YDFTVKD  G DV LS +KGKVL+IVNVAS+CGLT SNY++++ +Y+KYK QG EILAFPCNQFGGQEPGS  EI+   CTRFKAE+PIFDKVDVNG N AP+Y+ LKS   G F
Sbjct:    9 QSIYDFTVKDAKGNDVDLSIYKGKVLIIVNVASQCGLTNSNYTDMTEIYKKYKDQGLEILAFPCNQFGGQEPGSIEEIQNMVCTRFKAEYPIFDKVDVNGDNAAPLYKFLKSSKGGFF 126          

HSP 2 Score: 31.9574 bits (71), Expect = 1.148e-46
Identity = 12/18 (66.67%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  618 SAGGILGDLVKWNFEKFL 671
            S GG  GD +KWNF KFL
Sbjct:  121 SKGGFFGDSIKWNFSKFL 138          
BLAST of FC872958 vs. ExPASy Swiss-Prot
Match: GPX4_GOSHI (Probable phospholipid hydroperoxide glutathione peroxidase OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.623e-45
Identity = 83/119 (69.75%), Postives = 97/119 (81.51%), Query Frame = 2
Query:  281 KSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPE-IKEFACTRFKAEFPIFDKVDVNGPNTAPVYQLLKSKCWGNF 634
            +S+YDFTVKD  G DV LS +KGKVL+IVNVAS+CGLT SNY++L+ +Y+KYK QG EILAFPCNQFGGQEPGS  E I+   CTRFKAE+PIFDKVDVNG N AP+Y+ LKS   G F
Sbjct:    9 QSIYDFTVKDAKGNDVDLSIYKGKVLIIVNVASQCGLTNSNYTDLTEIYKKYKDQGLEILAFPCNQFGGQEPGSIEESIQNMVCTRFKAEYPIFDKVDVNGDNAAPLYKFLKSSKGGFF 127          

HSP 2 Score: 31.9574 bits (71), Expect = 1.623e-45
Identity = 12/18 (66.67%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  618 SAGGILGDLVKWNFEKFL 671
            S GG  GD +KWNF KFL
Sbjct:  122 SKGGFFGDSIKWNFSKFL 139          
The following BLAST results are available for this feature:
BLAST of FC872958 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 110
Match NameE-valueIdentityDescription
GPX1_ARATH1.925e-6572.50Phospholipid hydroperoxide glutathione peroxidase ... [more]
GPX7_ARATH3.156e-6066.48Putative glutathione peroxidase 7, chloroplastic O... [more]
GPX1_PEA1.915e-5766.29Phospholipid hydroperoxide glutathione peroxidase,... [more]
GPX6_ARATH2.184e-5161.59Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_CITSI7.478e-4972.50Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_SPIOL3.977e-4767.46Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_NICSY6.758e-4770.34Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_SOLLC1.148e-4669.49Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_TOBAC1.148e-4669.49Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_GOSHI1.623e-4569.75Probable phospholipid hydroperoxide glutathione pe... [more]

Pages

back to top
Libraries
Library NameType
AbsDevcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAI3DG11FM1 AbsDev Citrus clementina cDNA clone KN0AAI3DG11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC872958 ID=FC872958|Name=FC872958|organism=Citrus clementina|type=EST|length=678bp
ATTGCAACGCCCTTAAACCCCCGAACTGGTGTCGGACTCTATGTCGTTCG
AAGGATATCTGGCCTCACATAAACCGGATTTCACACCTAACAAAACATGC
CCTGCTGCATGGGCTACATCAATGGCGGCTTCATGGACTCCTACTAATTC
AATCAAAGCATCGATTGGGTCCGCTAAACCAGGCTTGCTTCAACATGGGC
TGTTTTCCCAATCTTCAAATTTGCCTGGGTTTTTCGTGAAACGTCGTTCC
TTTGGTGCTCACGCTACAGCTGCTACTGAGAAGTCTTTATATGACTTCAC
CGTCAAGGATATTGATGGTAAAGATGTTCCTCTTAGCAAGTTTAAGGGCA
AAGTTCTGTTGATTGTGAATGTCGCTTCAAGATGTGGCTTGACACCATCT
AATTACTCGGAGCTCTCTCACTTATATGAGAAGTACAAGACTCAAGGATT
TGAGATTCTAGCTTTCCCTTGCAATCAATTTGGTGGGCAAGAGCCTGGAT
CAAACCCTGAGATCAAGGAATTCGCTTGTACTAGGTTTAAGGCAGAATTT
CCCATATTTGACAAGGTTGATGTAAATGGACCAAACACAGCTCCAGTTTA
CCAGTTATTGAAGTCCAAGTGCTGGGGGAATTTTAGGCGACCTTGTCAAG
TGGAACTTTGAGAAGTTCTTAAGTGGAC
back to top