FC872966

Overview
NameFC872966
Unique NameFC872966
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length845
Libraries
Library NameType
AbsDevcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC872966 vs. ExPASy Swiss-Prot
Match: Y1222_ARATH (Uncharacterized protein At1g32220, chloroplastic OS=Arabidopsis thaliana GN=At1g32220 PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.085e-20
Identity = 46/99 (46.46%), Postives = 69/99 (69.70%), Query Frame = 3
Query:    3 FGSNSYMYKINGTANINAVKAAKEQGVKRFVFVSAADFGLVNYLL-RGYYEGKRATEEELMTELPHGGVILRPGFIHGTRQVGSIKLPLSVIGAPLEMV 296
            FG+   M +ING AN+ AV AAK+ GV +FV ++  D+ L  ++L  GY+ GKR  E EL+++ P  GV+LRPGFI+G R+V  I++PL ++G PL+ +
Sbjct:  137 FGNEEQMKRINGEANVTAVNAAKDFGVPKFVLITVHDYNLPPFILSNGYFTGKRNAEAELLSKYPTSGVVLRPGFIYGKRKVNGIEVPLDLVGEPLDKI 235          
The following BLAST results are available for this feature:
BLAST of FC872966 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y1222_ARATH2.085e-2046.46Uncharacterized protein At1g32220, chloroplastic O... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAI3DH09FM1 AbsDev Citrus clementina cDNA clone KN0AAI3DH09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC872966 ID=FC872966; Name=FC872966; organism=Citrus clementina; type=EST; length=845bp
GTTTCGGCTCAAATTCATATATGTACAAAATTAATGGGACCGCCAACATA
AACGCTGTAAAAGCTGCTAAAGAGCAAGGTGTAAAAAGGTTTGTGTTTGT
CTCTGCTGCTGACTTTGGTTTGGTAAATTATTTACTACGAGGATATTATG
AGGGAAAGAGAGCCACTGAAGAAGAGTTAATGACAGAACTGCCACATGGA
GGTGTGATCTTGAGGCCTGGCTTTATACATGGGACTCGTCAGGTTGGAAG
CATCAAGTTACCACTAAGTGTCATTGGGGCTCCATTAGAGATGGTAAATT
TTGGCATCTATATCTATCCTCAACAGATTCTTATCTTTACCCAGCAGTTC
ACTGAGTTTTGTGTCTCTGTTTCTAGAGAGCAGAACCTATGGGTGGTAAA
AGCACACATGGAAATAGATAGTCATTGTTGATGCCTTCCATCTATTTGCT
GTTTCTTAAAACTCACTGATGTTCGCTCATCCATGGACCATTGAAATTAT
AGAACCAAGGAAATTTCCTAGCTGTCTGAATGTCTGATCTAGGGAACACA
GGATAAAATGTGATGTATCAACAAACAATCCTTTTAAATGTTTTCTCGGT
ATATCTTTCTTATTCTTTTTGCAATGTTGCATATTGTCCATACACTCTGA
AAATAGTTCAATCAGAACGACTCTGTTATGTTGGTAACGACAGATTTCAT
ACGGGTCTGGCAGAGGGCTATGTTATTCAATTTTTATTTCTCCCTTTTCT
TCAATTAAATTCATGTTTAATGCAGATACTGAAACATGCAAAAGTGCTGA
CGGCAATTCCTCTTTGTTGGTCCGTTGTTAATACTCCAGTACATG
back to top