FC872968

Overview
NameFC872968
Unique NameFC872968
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length781
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14690 contig Ccv1_Contig14690:2088..2868. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC872968 vs. ExPASy Swiss-Prot
Match: AP1B1_RAT (AP-1 complex subunit beta-1 OS=Rattus norvegicus GN=Ap1b1 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.169e-29
Identity = 81/206 (39.32%), Postives = 110/206 (53.40%), Query Frame = 1
Query:  175 QGLQISAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQV-PQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEV---LKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNP 780
            +GL+IS   TRQ G +   +   N     +  F IQFN+N+FGLA    LQV   L P  +    LP+    ++    P + LQVAVKNN   V+YF+    LHVLF EDG+M+R  FL TW+ +P+ NE    ++D P     N EA    L +SN+F +AKR    QD+ Y S K+  G+  L EL    GNP    ++K   P
Sbjct:  733 KGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLNTVGSVMKMEPLNNLQVAVKNNID-VFYFSTLYPLHVLFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCP----LNTEAASSKLQSSNIFTVAKRTVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSFTLSLKCRAP 933          
BLAST of FC872968 vs. ExPASy Swiss-Prot
Match: AP1B1_HUMAN (AP-1 complex subunit beta-1 OS=Homo sapiens GN=AP1B1 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.076e-28
Identity = 78/195 (40.00%), Postives = 106/195 (54.36%), Query Frame = 1
Query:  175 QGLQISAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQV-PQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEV---LKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNP 747
            +GL+IS   TRQ G +   +   N     +  F IQFN+N+FGLA    LQV   L P  +    LP+    ++    P + LQVAVKNN   V+YF+    LH+LF EDG+M+R  FL TW+ +P+ NE    ++D P     N EA    L +SN+F +AKR    QD+ Y S K+  G+  L EL    GNP
Sbjct:  730 KGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNID-VFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCP----LNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNP 919          
BLAST of FC872968 vs. ExPASy Swiss-Prot
Match: AP1B1_MOUSE (AP-1 complex subunit beta-1 OS=Mus musculus GN=Ap1b1 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.406e-28
Identity = 80/206 (38.83%), Postives = 110/206 (53.40%), Query Frame = 1
Query:  175 QGLQISAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQVP-QLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEV---LKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNP 780
            +GL+IS   TRQ G +   +   N     +  F IQFN+N+FGLA    LQV   L P  +    LP+    ++    P + LQVAVKNN   V+YF+    LHVLF EDG+M+R  FL TW+ + + NE    ++D P     N EA  + L +SN+F +AKR    QD+ Y S K+  G+  L EL    GNP    ++K   P
Sbjct:  727 KGLEISGTFTRQAGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHVPLSPNQTVEISLPLNTVGSVLKMEPLNNLQVAVKNNID-VFYFSTLYPLHVLFVEDGKMDRQMFLATWKDIANENEAQFQIRDCP----LNTEAASNKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSFTLSLKCRAP 927          
BLAST of FC872968 vs. ExPASy Swiss-Prot
Match: AP2B1_RAT (AP-2 complex subunit beta OS=Rattus norvegicus GN=Ap2b1 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.828e-26
Identity = 75/203 (36.95%), Postives = 106/203 (52.22%), Query Frame = 1
Query:  175 QGLQISAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQV-PQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEVLKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNP 780
            +GL+IS   T + G ++  M F N     +  F IQFNKN+FG+     L +   L P  S    LP+     +    P + LQVAVKNN   V+YF+  I L+VLF EDG+MER  FL TW+ +P+ NE+   +    + N +     L  +N++ IAKR    QD+ Y S K+  G+  L EL    GNP    ++K   P
Sbjct:  721 KGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNID-VFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHL-NADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAP 921          
BLAST of FC872968 vs. ExPASy Swiss-Prot
Match: AP2B1_MOUSE (AP-2 complex subunit beta OS=Mus musculus GN=Ap2b1 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.828e-26
Identity = 75/203 (36.95%), Postives = 106/203 (52.22%), Query Frame = 1
Query:  175 QGLQISAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQV-PQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEVLKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNP 780
            +GL+IS   T + G ++  M F N     +  F IQFNKN+FG+     L +   L P  S    LP+     +    P + LQVAVKNN   V+YF+  I L+VLF EDG+MER  FL TW+ +P+ NE+   +    + N +     L  +N++ IAKR    QD+ Y S K+  G+  L EL    GNP    ++K   P
Sbjct:  721 KGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNID-VFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHL-NADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAP 921          
BLAST of FC872968 vs. ExPASy Swiss-Prot
Match: AP2B1_HUMAN (AP-2 complex subunit beta OS=Homo sapiens GN=AP2B1 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.828e-26
Identity = 75/203 (36.95%), Postives = 106/203 (52.22%), Query Frame = 1
Query:  175 QGLQISAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQV-PQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEVLKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNP 780
            +GL+IS   T + G ++  M F N     +  F IQFNKN+FG+     L +   L P  S    LP+     +    P + LQVAVKNN   V+YF+  I L+VLF EDG+MER  FL TW+ +P+ NE+   +    + N +     L  +N++ IAKR    QD+ Y S K+  G+  L EL    GNP    ++K   P
Sbjct:  721 KGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNID-VFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHL-NADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAP 921          
BLAST of FC872968 vs. ExPASy Swiss-Prot
Match: AP2B1_BOVIN (AP-2 complex subunit beta OS=Bos taurus GN=AP2B1 PE=1 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 3.828e-26
Identity = 75/203 (36.95%), Postives = 106/203 (52.22%), Query Frame = 1
Query:  175 QGLQISAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQV-PQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEVLKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNP 780
            +GL+IS   T + G ++  M F N     +  F IQFNKN+FG+     L +   L P  S    LP+     +    P + LQVAVKNN   V+YF+  I L+VLF EDG+MER  FL TW+ +P+ NE+   +    + N +     L  +N++ IAKR    QD+ Y S K+  G+  L EL    GNP    ++K   P
Sbjct:  721 KGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNID-VFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHL-NADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAP 921          
BLAST of FC872968 vs. ExPASy Swiss-Prot
Match: AP1B1_BOVIN (AP-1 complex subunit beta-1 OS=Bos taurus GN=AP2B1 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.828e-26
Identity = 75/203 (36.95%), Postives = 106/203 (52.22%), Query Frame = 1
Query:  175 QGLQISAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLAAGGALQV-PQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKNNQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSNEVLKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNP 780
            +GL+IS   T + G ++  M F N     +  F IQFNKN+FG+     L +   L P  S    LP+     +    P + LQVAVKNN   V+YF+  I L+VLF EDG+MER  FL TW+ +P+ NE+   +    + N +     L  +N++ IAKR    QD+ Y S K+  G+  L EL    GNP    ++K   P
Sbjct:  735 KGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNID-VFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHL-NADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAP 935          
BLAST of FC872968 vs. ExPASy Swiss-Prot
Match: AP1B_DICDI (AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.722e-18
Identity = 66/208 (31.73%), Postives = 107/208 (51.44%), Query Frame = 1
Query:  175 QGLQISAELTRQDGQVFYSMLFENNTQTPLDGFMIQFNKNTFGLA-AGGALQVPQLQPGTSGRTLLPMVLFQNMSAGPPSSLLQVAVKN-NQQPVWYFNDKISLHVLFTEDGRMERGSFLETWRSLPDSN----EVLKDLPGVVVSNVEATLDLLAASNMFFIAKRKNANQDVFYFSAKIPPGVPFLIELTTVIGNPGVKCAIKTPNP 780
            Q +QIS   TR  G++   +   N +Q  +  F IQF +N+FG++ A   L    ++ G S    +P+     +S  P + ++ +A+     Q  +YF     L  L TE GR++R S+L  W+S+P+SN    E+   LP V   +V++ L  L + N+F I ++K  NQ++ + S K    V  LIEL   I     +C+ KT +P
Sbjct:  721 QAIQISGAFTRFQGRINLELNLLNTSQQGMSKFKIQFYQNSFGISPADQILSCGAIEVGQSTDVTIPISCNGQIS-NPLNPVIDMAMMVLPSQERFYFKMNFPLLCLLTETGRLDRESYLSMWKSIPESNERSVEIQVRLPHV---DVDSILRRLNSKNIFEIVRKKAPNQEISFLSCKTESSVYILIELAFNISTNTCRCSSKTTSP 924          
The following BLAST results are available for this feature:
BLAST of FC872968 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
AP1B1_RAT2.169e-2939.32AP-1 complex subunit beta-1 OS=Rattus norvegicus G... [more]
AP1B1_HUMAN1.076e-2840.00AP-1 complex subunit beta-1 OS=Homo sapiens GN=AP1... [more]
AP1B1_MOUSE1.406e-2838.83AP-1 complex subunit beta-1 OS=Mus musculus GN=Ap1... [more]
AP2B1_RAT3.828e-2636.95AP-2 complex subunit beta OS=Rattus norvegicus GN=... [more]
AP2B1_MOUSE3.828e-2636.95AP-2 complex subunit beta OS=Mus musculus GN=Ap2b1... [more]
AP2B1_HUMAN3.828e-2636.95AP-2 complex subunit beta OS=Homo sapiens GN=AP2B1... [more]
AP2B1_BOVIN3.828e-2636.95AP-2 complex subunit beta OS=Bos taurus GN=AP2B1 P... [more]
AP1B1_BOVIN3.828e-2636.95AP-1 complex subunit beta-1 OS=Bos taurus GN=AP2B1... [more]
AP1B_DICDI1.722e-1831.73AP-1 complex subunit beta OS=Dictyostelium discoid... [more]
back to top
Libraries
Library NameType
AbsDevcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAI3DH12FM1 AbsDev Citrus clementina cDNA clone KN0AAI3DH12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC872968 ID=FC872968|Name=FC872968|organism=Citrus clementina|type=EST|length=781bp
TATGCTGCAACAAGACAGCCAGCACCTCCTCCAGCTGCTCCTGTGTCTCC
TCCAGTGCCTGATTTACTTGGTGATCTGATAGGCTTAGATAATAGTGCTG
CCATCGTCCCTGCTGACCAGGCTGCAGCTTCTCCTGTCCCTGCTTTACCT
GTTGTGCTACCGGCATCAACTGGACAGGGTCTGCAAATCAGTGCAGAGTT
AACAAGACAGGATGGTCAAGTATTTTACAGCATGCTGTTTGAGAACAATA
CACAGACTCCACTTGATGGGTTCATGATTCAATTTAACAAGAACACATTT
GGTCTTGCAGCTGGTGGAGCCCTTCAGGTGCCACAATTGCAACCGGGAAC
TTCAGGCAGGACACTGTTGCCAATGGTATTGTTCCAGAATATGTCTGCTG
GTCCTCCAAGCTCACTTCTGCAAGTAGCTGTGAAGAATAATCAGCAGCCA
GTATGGTACTTCAATGATAAGATCTCTCTTCATGTGCTTTTCACTGAGGA
TGGGAGAATGGAGAGAGGAAGCTTTCTGGAGACGTGGAGGTCCCTTCCTG
ATTCCAACGAGGTATTGAAGGACCTTCCAGGGGTTGTGGTGAGCAACGTG
GAAGCAACTCTGGATCTGCTGGCTGCATCAAACATGTTCTTTATAGCAAA
GCGCAAGAATGCAAACCAGGATGTTTTTTACTTCTCTGCTAAGATCCCTC
CTGGTGTACCCTTCTTGATTGAACTCACCACAGTTATTGGAAATCCTGGG
GTCAAGTGTGCGATTAAGACTCCAAATCCTG
back to top