FC872971

Overview
NameFC872971
Unique NameFC872971
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length527
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC872971 vs. ExPASy Swiss-Prot
Match: FAAA_HUMAN (Fumarylacetoacetase OS=Homo sapiens GN=FAH PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.122e-20
Identity = 43/70 (61.43%), Postives = 57/70 (81.43%), Query Frame = 1
Query:    1 LGTGTISGPEPESLGCLLELTWNGQKPLSL-DGFTRKFLEDGDEVTFTGFCKGNGYTVGFGTCSGKIVPS 207
            L +GTISGPEPE+ G +LEL+W G KP+ L +G TRKFL DGDEV  TG+C+G+GY +GFG C+GK++P+
Sbjct:  346 LASGTISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGYRIGFGQCAGKVLPA 415          
BLAST of FC872971 vs. ExPASy Swiss-Prot
Match: FAAA_BOVIN (Fumarylacetoacetase OS=Bos taurus GN=FAH PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.499e-20
Identity = 43/70 (61.43%), Postives = 56/70 (80.00%), Query Frame = 1
Query:    1 LGTGTISGPEPESLGCLLELTWNGQKPLSL-DGFTRKFLEDGDEVTFTGFCKGNGYTVGFGTCSGKIVPS 207
            L +GTISGPEPES GC+LEL+W G + + L +G TRKFL DGDEV  TG C+G+GY +GFG C+GK++P+
Sbjct:  346 LASGTISGPEPESFGCMLELSWKGTRAVELGNGQTRKFLLDGDEVIMTGHCQGDGYRIGFGQCAGKVLPA 415          
BLAST of FC872971 vs. ExPASy Swiss-Prot
Match: FAAA_DICDI (Fumarylacetoacetase OS=Dictyostelium discoideum GN=fah PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.516e-17
Identity = 41/72 (56.94%), Postives = 51/72 (70.83%), Query Frame = 1
Query:    1 LGTGTISGPEPESLGCLLELTWNGQKPLSLDGFT---RKFLEDGDEVTFTGFCKGNGYTVGFGTCSGKIVPS 207
            LGTGTISGP  +S G +LEL+W G K +SL   T   RKF++DGD V  +G CKGNGY +GFG C G I+P+
Sbjct:  352 LGTGTISGPTEDSYGSMLELSWKGSKVVSLGTETNEERKFIQDGDSVILSGLCKGNGYQIGFGNCEGTILPA 423          
BLAST of FC872971 vs. ExPASy Swiss-Prot
Match: FAAA_RAT (Fumarylacetoacetase OS=Rattus norvegicus GN=Fah PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.586e-17
Identity = 40/70 (57.14%), Postives = 52/70 (74.29%), Query Frame = 1
Query:    1 LGTGTISGPEPESLGCLLELTWNGQKPLSL-DGFTRKFLEDGDEVTFTGFCKGNGYTVGFGTCSGKIVPS 207
            L +GTISG +PES G +LEL+W G K + +  G TR FL DGDEV  TG C+G+GY VGFG C+GK++P+
Sbjct:  346 LASGTISGSDPESFGSMLELSWKGTKAIDVGQGQTRTFLLDGDEVIITGHCQGDGYRVGFGQCAGKVLPA 415          
BLAST of FC872971 vs. ExPASy Swiss-Prot
Match: FAAA_MOUSE (Fumarylacetoacetase OS=Mus musculus GN=Fah PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.586e-17
Identity = 40/70 (57.14%), Postives = 52/70 (74.29%), Query Frame = 1
Query:    1 LGTGTISGPEPESLGCLLELTWNGQKPLSL-DGFTRKFLEDGDEVTFTGFCKGNGYTVGFGTCSGKIVPS 207
            L +GTISG +PES G +LEL+W G K + +  G TR FL DGDEV  TG C+G+GY VGFG C+GK++P+
Sbjct:  346 LASGTISGSDPESFGSMLELSWKGTKAIDVGQGQTRTFLLDGDEVIITGHCQGDGYRVGFGQCAGKVLPA 415          
The following BLAST results are available for this feature:
BLAST of FC872971 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
FAAA_HUMAN1.122e-2061.43Fumarylacetoacetase OS=Homo sapiens GN=FAH PE=1 SV... [more]
FAAA_BOVIN2.499e-2061.43Fumarylacetoacetase OS=Bos taurus GN=FAH PE=2 SV=1[more]
FAAA_DICDI1.516e-1756.94Fumarylacetoacetase OS=Dictyostelium discoideum GN... [more]
FAAA_RAT2.586e-1757.14Fumarylacetoacetase OS=Rattus norvegicus GN=Fah PE... [more]
FAAA_MOUSE2.586e-1757.14Fumarylacetoacetase OS=Mus musculus GN=Fah PE=1 SV... [more]
back to top
Libraries
Library NameType
AbsDevcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAI2BA03FM1 AbsDev Citrus clementina cDNA clone KN0AAI2BA03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC872971 ID=FC872971|Name=FC872971|organism=Citrus clementina|type=EST|length=527bp
CTTGGAACTGGCACCATCAGTGGACCTGAGCCAGAATCTCTTGGATGCTT
GCTGGAGTTAACATGGAATGGACAAAAGCCGCTTTCACTAGATGGGTTTA
CTCGTAAATTCCTGGAAGATGGAGATGAAGTGACATTTACTGGTTTTTGC
AAGGGAAACGGTTACACTGTTGGATTTGGAACGTGTTCAGGAAAAATAGT
CCCATCAACCCCTTAGTGAAGCAACCACCCTTGGTGATCAAAGCGAGTGT
CTGCCCATCTGATGAAATCAATTAGAGTGGTTGTGTTTACATTGAATCCG
CATCTGGTCAGGTCCATGTGTAATAGATGTAATTGAATTTGTAGCTAACA
AGACCGCGAAATGAAGACCTGAAGATGGGACGATTGAAAAAAGTGCATGT
GATGAGAGTATTGAACTAAATGAAGTGAAAATCTTCTTTTCTTTTCAGTT
TATAATTTTTTATTTGGATCTCAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top