FC872972

Overview
NameFC872972
Unique NameFC872972
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length792
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC872972_ssr177 microsatellite FC872972_ssr177:177..196. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig1155 contig Ccv1_Contig1155:1..792. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC872972 vs. ExPASy Swiss-Prot
Match: JKD_ARATH (Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 9.513e-65
Identity = 120/188 (63.83%), Postives = 135/188 (71.81%), Query Frame = 3
Query:  276 LQMMSGNAFTIPSSLGGFVHQEXXXXXXXXXXXXXXXXX----------------RNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGXXXXXXXXXXXXYAVQSDWKAHSQTCGTREYKC 791
            +QM+ G+ F+I SS+GGFVHQE                                 RN PGTPDPDA+VIALSP TLMATNRF+CEICNKGFQRDQNLQLHRRGHNLPWKL+QR+ ++VIKKKVYICP KTCVHH+ SRALGDLTGIKKH+SRKHG            YAVQSDWKAH++TCGTREYKC
Sbjct:    1 MQMIPGDPFSISSSMGGFVHQETHLHHLQQQIPDLNPNSNPNPNAKPNSSSAKKKRNQPGTPDPDADVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRSKQEVIKKKVYICPIKTCVHHDASRALGDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQSDWKAHAKTCGTREYKC 188          
BLAST of FC872972 vs. ExPASy Swiss-Prot
Match: MGP_ARATH (Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.203e-59
Identity = 104/133 (78.20%), Postives = 116/133 (87.22%), Query Frame = 3
Query:  393 RNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGXXXXXXXXXXXXYAVQSDWKAHSQTCGTREYKC 791
            RNLPG PDP+AEVIALSPKTLMATNRF+CEIC KGFQRDQNLQLHRRGHNLPWKL+QRT+K+V +K+VY+CPEK+CVHH P+RALGDLTGIKKHF RKHG            YAVQSDWKAHS+TCGTREY+C
Sbjct:   44 RNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEV-RKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKCAKRYAVQSDWKAHSKTCGTREYRC 175          
BLAST of FC872972 vs. ExPASy Swiss-Prot
Match: NUC_ARATH (Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 4.573e-59
Identity = 110/168 (65.48%), Postives = 122/168 (72.62%), Query Frame = 3
Query:  288 SGNAFTIPSSLGGFVHQEXXXXXXXXXXXXXXXXXRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQRTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGXXXXXXXXXXXXYAVQSDWKAHSQTCGTREYKC 791
            SG+ F  P S     H E                 RNLPG PDP+AEVIALSP TLMATNRF+CE+C KGFQRDQNLQLHRRGHNLPWKL+QRT+K+V +K+VY+CPEKTCVHH  SRALGDLTGIKKHF RKHG            YAVQSDWKAHS+TCGTREY+C
Sbjct:   11 SGSGFAQPQSSSTLDHDESLINPPLVKKK------RNLPGNPDPEAEVIALSPTTLMATNRFLCEVCGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEV-RKRVYVCPEKTCVHHHSSRALGDLTGIKKHFCRKHGEKKWTCEKCAKRYAVQSDWKAHSKTCGTREYRC 171          
The following BLAST results are available for this feature:
BLAST of FC872972 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
JKD_ARATH9.513e-6563.83Zinc finger protein JACKDAW OS=Arabidopsis thalian... [more]
MGP_ARATH1.203e-5978.20Zinc finger protein MAGPIE OS=Arabidopsis thaliana... [more]
NUC_ARATH4.573e-5965.48Zinc finger protein NUTCRACKER OS=Arabidopsis thal... [more]
back to top
Libraries
Library NameType
AbsDevcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAI2BA06FM1 AbsDev Citrus clementina cDNA clone KN0AAI2BA06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC872972 ID=FC872972|Name=FC872972|organism=Citrus clementina|type=EST|length=792bp
CAGCAATCATAAGTTGTTGGAGTTTTCTTTTGAAATTGATCAAAACAAAA
CCAGATCTCTGTAACAAGAGTCCGAAATATATTTTTGTTTTTAGATTAAA
ATTTTGAGTTTTTTTTTCCTCCTTTCCTTCTCTTTTCTTGTCTTTTGGCT
TGAATCTCAGAGTCATCAGAATTTGAATATATATATATATATATATACCA
AACATTTATCAGCTTCTGTTTGGAGGAAAAAAAAAAGCACAAAACAAAAC
CCTTAGTTTTTTGCACTTTGATAGCTTGCAAATGATGTCTGGTAATGCTT
TTACAATACCCTCTTCCTTAGGAGGGTTTGTTCATCAAGAACAAAATCCC
AACCCTAACCCTAAACCTAATCAGGCTGCCAGTAAAAAGAAGAGGAATTT
ACCGGGAACTCCAGATCCAGATGCTGAGGTTATTGCTCTATCCCCAAAGA
CACTCATGGCAACCAACAGATTCATATGTGAAATATGCAATAAGGGTTTC
CAAAGAGACCAAAACTTACAGCTTCATCGAAGAGGACATAATCTTCCATG
GAAGCTGAGGCAAAGAACCAACAAAGACGTCATCAAGAAGAAAGTTTATA
TCTGCCCAGAAAAGACTTGTGTTCATCACGAACCATCGAGGGCTCTCGGT
GATTTGACGGGTATAAAGAAGCATTTTAGCAGAAAACATGGAGAAAAGAA
ATGGAAGTGTGAGAAATGTTCAAAGAAATATGCAGTTCAATCTGACTGGA
AAGCTCACTCCCAGACTTGTGGCACCCGAGAGTATAAGTGTG
back to top