FC875258

Overview
NameFC875258
Unique NameFC875258
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length516
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig2680 contig Ccv1_Contig2680:1..516. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875258 vs. ExPASy Swiss-Prot
Match: C94A1_VICSA (Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 3.730e-34
Identity = 63/148 (42.57%), Postives = 100/148 (67.57%), Query Frame = 3
Query:    3 RNRHRFHDWVAEQLSGTPSSTIQVNSFLNLSNGVATADPANVRHLLHTNFPNYVKGSRFSAVLRELLGDGIFNADGPTWTLQRKIASHEFSTKSLKNFITDVVESEITERLLPSLCIACDEGLVIDLQKVLEDFTFNNMCNVAFGVDP 446
            +N HR   W+++ +  +PS+T Q++  L     + T +P+ V+H+L   F NY KG+ F+  L + LG GIFN +GP W  QR++ASHEF+TKS++NF+  +V++E+T RL+P L  +     ++D Q +L+ FTF+N+CN+AFG DP
Sbjct:   62 KNLHRRIQWLSDIVQISPSATFQLDGTLG-KRQIITGNPSTVQHILKNQFSNYQKGTTFTNTLSDFLGTGIFNTNGPNWKFQRQVASHEFNTKSIRNFVEHIVDTELTNRLIPILTSSTQTNNILDFQDILQRFTFDNICNIAFGYDP 208          
BLAST of FC875258 vs. ExPASy Swiss-Prot
Match: C94A2_VICSA (Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.467e-30
Identity = 66/151 (43.71%), Postives = 96/151 (63.58%), Query Frame = 3
Query:    6 NRHRFHDWVAEQLSGTPSSTIQVNSFLNLSNGVATADPANVRHLLHTNFPNYVKGSRFSAVLRELLGDGIFNADGPTWTLQRKIASHEFSTKSLKNFITDVVESEITERLLPSLCIACDEGLVIDLQKVLEDFTFNNMCNVAFGVDPSTMV 458
            N HR   W ++ L   PSST  ++     +  V TA PA V+H+L TNF  Y KG  F   + + LGDGIFNADG +W  QR+I+SHEF+T+SL+ F+  VV+ E+++RL+P L  A +    +D Q +L+  TF+N+C +AFG DP  ++
Sbjct:   58 NFHRRIQWTSDILQTIPSSTFVLHRPFG-ARQVFTAQPAVVQHILRTNFTCYGKGLTFYQSINDFLGDGIFNADGESWKFQRQISSHEFNTRSLRKFVETVVDVELSDRLVPVLSQASNSQTTLDFQDILQRLTFDNICMIAFGYDPEYLL 207          
BLAST of FC875258 vs. ExPASy Swiss-Prot
Match: C86A1_ARATH (Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 8.329e-26
Identity = 63/155 (40.65%), Postives = 85/155 (54.84%), Query Frame = 3
Query:    6 NRHRFHDWVAEQL---SGTPSSTIQVNSFLNLSNG--VATADPANVRHLLHTNFPNYVKGSRFSAVLRELLGDGIFNADGPTWTLQRKIASHEFSTKSLKNFITDVVESEITERLLPSLCIACDEGLVIDLQKVLEDFTFNNMCNVAFGVDPSTM 455
            NR R HDW+A+ L    GT  +   V  F+  + G    T  P NV H+L T F NY KG  + A   +LLG GIFN+DG TW +QRK A+ EF+T++L+  +   V   I  RL   L  A      +DLQ +    TF+N+C + FG DP T+
Sbjct:   48 NRSRIHDWIADNLRATGGTYQTCTMVIPFVAKAQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNSDGDTWLMQRKTAALEFTTRTLRQAMARWVNGTIKNRLWLILDRAVQNNKPVDLQDLFLRLTFDNICGLTFGKDPETL 202          
BLAST of FC875258 vs. ExPASy Swiss-Prot
Match: C86A2_ARATH (Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.203e-24
Identity = 63/153 (41.18%), Postives = 84/153 (54.90%), Query Frame = 3
Query:    9 RHRFHDWVAEQL---SGTPSSTIQVNSFLNLSNGVATA--DPANVRHLLHTNFPNYVKGSRFSAVLRELLGDGIFNADGPTWTLQRKIASHEFSTKSLKNFITDVVESEITERLLPSLCIACDEGLVIDLQKVLEDFTFNNMCNVAFGVDPST 452
            R R HDW+ E L    GT  + I    FL    G+ T   DP N+ H+L T F NY KG  + AV  + LG GIFN+DG TW  QRK A+ EF+T++L+  +   V   I  R  P L  A +    +DLQ ++   TF+N+C +AFG D  T
Sbjct:   46 RDRMHDWITENLRACGGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIFNSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRGIKLRFCPILETAQNNYEPVDLQDLILRLTFDNICGLAFGKDTRT 198          
BLAST of FC875258 vs. ExPASy Swiss-Prot
Match: C04C1_PINTA (Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 5.782e-19
Identity = 53/150 (35.33%), Postives = 84/150 (56.00%), Query Frame = 3
Query:    6 NRHRFHDWVAEQLSGTPSSTIQVNSFLNLSNGVATADPANVRHLLHTNFPNYVKGSRFSAVLRELLGDGIFNADGPTWTLQRKIASHEFSTKSLKNFITDVVESEITERLLPSLCIACDEGLVIDLQKVLEDFTFNNMCNVAFGVDPSTM 455
            N  R HD+  +Q     +  +   +     + V T DP NV H+L TNF NY KG+    ++++LLGDGIFN DG  W  QRK+AS EF++K LK+F + V  +    +L   L  A    L +++Q +    + +++C V FG+D +++
Sbjct:   49 NFERLHDYHTDQAQRYKTFRVVYPT----CSYVFTTDPVNVEHILKTNFANYDKGTFNYDIMKDLLGDGIFNVDGDKWRQQRKLASSEFASKVLKDFSSGVFCNN-AAKLANILAQAAKLNLSVEMQDLFMRSSLDSICKVVFGIDINSL 193          
The following BLAST results are available for this feature:
BLAST of FC875258 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
C94A1_VICSA3.730e-3442.57Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE... [more]
C94A2_VICSA1.467e-3043.71Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE... [more]
C86A1_ARATH8.329e-2640.65Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CY... [more]
C86A2_ARATH1.203e-2441.18Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CY... [more]
C04C1_PINTA5.782e-1935.33Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 P... [more]
back to top
Libraries
Library NameType
CTVClemen1cdna_library
Properties
Property NameValue
Genbank descriptionC31402A01EF CTVClemen1 Citrus clementina cDNA clone C31402A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875258 ID=FC875258|Name=FC875258|organism=Citrus clementina|type=EST|length=516bp
TCCGCAACCGCCACCGCTTCCACGACTGGGTCGCCGAGCAGCTCTCCGGA
ACCCCATCTTCCACTATTCAAGTCAACTCCTTCCTCAACCTCTCCAATGG
CGTGGCCACCGCCGACCCCGCCAATGTCCGCCACTTGCTCCACACCAACT
TCCCCAACTACGTCAAAGGCTCCCGCTTCTCCGCCGTCCTCCGCGAGCTC
CTCGGCGACGGCATCTTCAACGCCGACGGACCCACCTGGACTCTCCAGCG
CAAGATCGCCAGCCACGAGTTCAGCACCAAGTCCCTCAAGAACTTCATAA
CGGACGTGGTCGAATCTGAGATCACCGAACGGCTCTTGCCGTCCCTGTGC
ATCGCCTGCGACGAGGGCTTGGTGATTGATTTGCAAAAAGTGTTGGAAGA
TTTCACTTTTAATAATATGTGCAACGTTGCATTCGGTGTTGATCCTTCTA
CTATGGTGGAAAAATTCTATTTATTGAGCATTTACGACGCACCGAGATTG
CTGGAAAGATCATGTC
back to top