FC875264

Overview
NameFC875264
Unique NameFC875264
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length731
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10190 contig Ccv1_Contig10190:1..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875264 vs. ExPASy Swiss-Prot
Match: HMGL_SOYBN (HMG1/2-like protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 9.928e-34
Identity = 72/119 (60.50%), Postives = 91/119 (76.47%), Query Frame = 1
Query:  121 MKGGKSKSDTRNA--KLSVNXXXXXXXXXXXXXXX----DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEG 459
            MKGGKSK++++ A  KL+VN                   DPNKPKRP SAFFVFMEEFR+ + K+HP+NK+V+AVGKA G KWK+MS+A+KAPYVAK+EKRKVEYEK+M+ YN++QAEG
Sbjct:    1 MKGGKSKTESKRADPKLAVNKKGAATKARKPAGKGKAAKDPNKPKRPPSAFFVFMEEFRKVFNKEHPENKAVSAVGKAAGAKWKTMSDAEKAPYVAKSEKRKVEYEKNMRAYNKKQAEG 119          
BLAST of FC875264 vs. ExPASy Swiss-Prot
Match: HMGL_IPONI (HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.342e-30
Identity = 66/113 (58.41%), Postives = 84/113 (74.34%), Query Frame = 1
Query:  121 MKGGKSKSDTRNAKLSVNXXXXXXXXXXXXXXXDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEG 459
            MKGGKSK+ + N KL+V                DPNKPKRP SAFFVFME+FR+ YK+ HP NKSVA VGKAGG+KWK ++ A+KAP+++KAEKRK EYEK+++ YN++QA G
Sbjct:    1 MKGGKSKAKSDN-KLAVKKQAADTKKTKKAVK-DPNKPKRPPSAFFVFMEDFRKTYKEKHPNNKSVAVVGKAGGDKWKQLTAAEKAPFISKAEKRKQEYEKNLQAYNKKQAAG 111          
BLAST of FC875264 vs. ExPASy Swiss-Prot
Match: HMGL_VICFA (HMG1/2-like protein OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.362e-29
Identity = 67/116 (57.76%), Postives = 81/116 (69.83%), Query Frame = 1
Query:  121 MKGGKSKSDTRNA--KLSVNXXXXXXXXXXXXXXX-----DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 447
            MKGGKSK +++ A  KL+VN                    DPNKPKRP SAFFVFM +FREQYKKDHP NKSVAAVGKA GE+WKS+SE +KAPYV +A K+K EYE  ++ YN++
Sbjct:    1 MKGGKSKGESKKAETKLAVNKKGAAATKGGKKPAKGKEPKDPNKPKRPPSAFFVFMADFREQYKKDHPNNKSVAAVGKACGEEWKSLSEEEKAPYVDRALKKKEEYEITLQAYNKK 116          
BLAST of FC875264 vs. ExPASy Swiss-Prot
Match: MNB1B_MAIZE (DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.040e-27
Identity = 64/118 (54.24%), Postives = 81/118 (68.64%), Query Frame = 1
Query:  121 MKGGKSKSDTR-NAKLSVNXXXXXXXXXXXXXXX--DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTK 465
            MKG KSK   + +AKL+V                  DPNKPKR  SAFFVFMEEFR+++K+ +PKNKSVAAVGKA G++WKS+SE+DKAPYVAKA K K+EY K +  YN+ ++   K
Sbjct:    1 MKGAKSKGAAKADAKLAVKSKGAEKPAKGRKGKAGKDPNKPKRAPSAFFVFMEEFRKEFKEKNPKNKSVAAVGKAAGDRWKSLSESDKAPYVAKANKLKLEYNKAIAAYNKGESTAAK 118          
BLAST of FC875264 vs. ExPASy Swiss-Prot
Match: HMGL_WHEAT (HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.300e-25
Identity = 63/115 (54.78%), Postives = 78/115 (67.83%), Query Frame = 1
Query:  121 MKGGKSKSDTR-NAKLSVNXXXXXXXXXXXXXXX---DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 453
            MKG KSK   + +AKL+V                   DPNKPKR  SAFFVFM EFRE++K+ +PKNKSVAAVGKA GE+WKS+SE++KAPYVAKA K K EY K +  YN+ ++
Sbjct:    1 MKGAKSKGAAKADAKLAVKSKGAEKPAAKGKKGKAGKDPNKPKRAPSAFFVFMGEFREEFKQKNPKNKSVAAVGKAAGERWKSLSESEKAPYVAKANKLKGEYNKAIAAYNKGES 115          
BLAST of FC875264 vs. ExPASy Swiss-Prot
Match: HMGT_ONCMY (High mobility group-T protein OS=Oncorhynchus mykiss PE=2 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 2.542e-13
Identity = 36/76 (47.37%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 447
            DPN PKRP+SAFF+F  +FR Q K + P   S+  V K  GEKW +++  DK PY  KA + K +YEKD+  Y  +
Sbjct:   90 DPNAPKRPSSAFFIFCADFRPQVKGETP-GLSIGDVAKKLGEKWNNLTAEDKVPYEKKASRLKEKYEKDITAYRNK 164          
BLAST of FC875264 vs. ExPASy Swiss-Prot
Match: HMGB3_MOUSE (High mobility group protein B3 OS=Mus musculus GN=Hmgb3 PE=2 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 4.336e-13
Identity = 36/76 (47.37%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 447
            DPN PKRP S FF+F  EFR + K  +P   S+  V K  GE W ++S+ +K PYV KA K K +YEKD+ +Y  +
Sbjct:   89 DPNAPKRPPSGFFLFCSEFRPKIKSTNP-GISIGDVAKKLGEMWNNLSDNEKQPYVTKAAKLKEKYEKDVADYKSK 163          
BLAST of FC875264 vs. ExPASy Swiss-Prot
Match: HMGB3_HUMAN (High mobility group protein B3 OS=Homo sapiens GN=HMGB3 PE=1 SV=4)

HSP 1 Score: 74.7146 bits (182), Expect = 5.663e-13
Identity = 34/76 (44.74%), Postives = 49/76 (64.47%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 447
            DPN PKRP S FF+F  EFR + K  +P   S+  V K  GE W ++++++K PY+ KA K K +YEKD+ +Y  +
Sbjct:   89 DPNAPKRPPSGFFLFCSEFRPKIKSTNP-GISIGDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSK 163          
BLAST of FC875264 vs. ExPASy Swiss-Prot
Match: HMGB3_BOVIN (High mobility group protein B3 OS=Bos taurus GN=HMGB3 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 5.663e-13
Identity = 35/76 (46.05%), Postives = 49/76 (64.47%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 447
            DPN PKRP S FF+F  EFR + K  +P   S+  V K  GE W ++S+++K PY+ KA K K +YEKD+ +Y  +
Sbjct:   89 DPNAPKRPPSGFFLFCSEFRPKIKSANP-GISIGDVAKKLGEMWNNLSDSEKQPYINKAAKLKEKYEKDVADYKSK 163          
BLAST of FC875264 vs. ExPASy Swiss-Prot
Match: HMGB3_CHICK (High mobility group protein B3 OS=Gallus gallus GN=HMGB3 PE=2 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 9.660e-13
Identity = 36/76 (47.37%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 447
            DPN PKRP SAFF+F  EFR + K  +P   S+  V K  GE W ++S+ +K PY  KA K K +YEKD+ +Y  +
Sbjct:   89 DPNAPKRPPSAFFLFCSEFRPKIKSTNP-GISIGDVAKKLGEMWNNLSDGEKQPYNNKAAKLKEKYEKDVADYKSK 163          
The following BLAST results are available for this feature:
BLAST of FC875264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
HMGL_SOYBN9.928e-3460.50HMG1/2-like protein OS=Glycine max PE=2 SV=1[more]
HMGL_IPONI1.342e-3058.41HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1[more]
HMGL_VICFA7.362e-2957.76HMG1/2-like protein OS=Vicia faba PE=2 SV=1[more]
MNB1B_MAIZE4.040e-2754.24DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=... [more]
HMGL_WHEAT1.300e-2554.78HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1[more]
HMGT_ONCMY2.542e-1347.37High mobility group-T protein OS=Oncorhynchus myki... [more]
HMGB3_MOUSE4.336e-1347.37High mobility group protein B3 OS=Mus musculus GN=... [more]
HMGB3_HUMAN5.663e-1344.74High mobility group protein B3 OS=Homo sapiens GN=... [more]
HMGB3_BOVIN5.663e-1346.05High mobility group protein B3 OS=Bos taurus GN=HM... [more]
HMGB3_CHICK9.660e-1347.37High mobility group protein B3 OS=Gallus gallus GN... [more]

Pages

back to top
Libraries
Library NameType
CTVClemen1cdna_library
Properties
Property NameValue
Genbank descriptionC31402A07EF CTVClemen1 Citrus clementina cDNA clone C31402A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875264 ID=FC875264|Name=FC875264|organism=Citrus clementina|type=EST|length=731bp
GAGCTCACAAACAACGCATCCGCTATTCACATCTGCGTCTCTCTCTTTTT
CTCTTTCCTCTTTTTCTCTCATTTGAAGCCCTAACCCTAGCTCTATCTTT
CTTCAGAAACAGGATTTGAAATGAAAGGAGGTAAATCAAAGTCAGATACC
AGAAACGCCAAGCTCTCTGTGAACAAGAAGCCTGCCAAAGCTGGACGAAA
ATCGGGAAAGGCAGCTAAGGACCCGAACAAGCCAAAGAGGCCAGCCAGCG
CCTTCTTTGTTTTCATGGAAGAATTCCGTGAACAATACAAGAAGGATCAT
CCTAAGAACAAATCAGTTGCTGCTGTTGGTAAAGCTGGTGGTGAGAAATG
GAAGTCAATGTCTGAAGCTGATAAAGCACCGTATGTTGCTAAGGCAGAGA
AGCGCAAGGTTGAGTATGAGAAGGATATGAAAAACTACAATAGGAGACAG
GCGGAGGGAACTAAGCCGGAGGAAGAAGAGGAGTCTGAGAAGTCTATGTC
AGAGGTGAATGATGAGGATGATGATGAAGAAGGCAGTGGCGAGGAGGATG
ATGATGAATAGAAGTTGAAGGAAGAAATTAGCATAGTCATGTTAGGCTGT
GACAATGTTTCAAACAACATATGTTAATGCTTTGTGCTTCCATGTTAATT
TTTTTGGATGCTTTCATCATCTTCATCATCATGTAAGAGAATCATGTTGC
TCCCTCCTCGACATTTTCTTATGCCTGCCTT
back to top