FC875267

Overview
NameFC875267
Unique NameFC875267
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length678
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC875267 vs. ExPASy Swiss-Prot
Match: NAC4_ARATH (NAC domain-containing protein 4 OS=Arabidopsis thaliana GN=NAC004 PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.213e-19
Identity = 56/129 (43.41%), Postives = 72/129 (55.81%), Query Frame = 2
Query:  116 VGFRFYPTDEQII-LLLTMKRRDPAGFSV-RTIKEIDLYSFEPWELPCHSEIQSEEEVWYFFCEPCYKNAESKRVRRRTKEGYWKKTGRGSNIKRKY-KTEVIGTKKILSFSRDDAAAEKDKTEWVIHE 493
            VGFRF P DE+I+   L  K  D     V   I  +D+ SFEPW+LP  S I+S + VWYFF     K     + RRRT  G+WKKTG+   + RK    E IG K++L F   D +    KT+WV+HE
Sbjct:    5 VGFRFRPNDEEIVDHYLRPKNLDSDTSHVDEVISTVDICSFEPWDLPSKSMIKSRDGVWYFFSVKEMKYNRGDQQRRRTNSGFWKKTGKTMTVMRKRGNREKIGEKRVLVFKNRDGS----KTDWVMHE 129          
BLAST of FC875267 vs. ExPASy Swiss-Prot
Match: NAC54_ARATH (Protein CUP-SHAPED COTYLEDON 1 OS=Arabidopsis thaliana GN=NAC054 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.611e-19
Identity = 54/154 (35.06%), Postives = 80/154 (51.95%), Query Frame = 2
Query:  119 GFRFYPTDEQIILLLTMKRRDPAGFSVRTIKEIDLYSFEPWELPCHSEIQSEEEVWYFFCEPCYKNAESKRVRRRTKEGYWKKTGRGSNIKRKYKTEVIGTKKILSFSRDDAAAEKDKTEWVIHEIAVENSPDFEVLASVLELHMCCEIVCLFS 580
            GFRF+PTDE++I    +K+   + FS   I ++DL   EPWELP   + +  E+ WYFF     K     R  R T+ GYWK TG+   IK      ++G KK L F +   A + +K+ WV+HE  ++    +  ++S  +       VCL S
Sbjct:   23 GFRFHPTDEELITYYLLKKVLDSNFSCAAISQVDLNKSEPWELP--EKAKMGEKEWYFFTLRDRKYPTGLRTNRATEAGYWKATGKDREIKSSKTKSLLGMKKTLVFYK-GRAPKGEKSCWVMHEYRLDGKFSYHYISSSAKDEWVLCKVCLKS 173          
BLAST of FC875267 vs. ExPASy Swiss-Prot
Match: NAC5_ARATH (NAC domain-containing protein 5 OS=Arabidopsis thaliana GN=NAC005 PE=2 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 2.288e-18
Identity = 55/142 (38.73%), Postives = 81/142 (57.04%), Query Frame = 2
Query:  104 MDSLVGFRFYPTDEQII-LLLTMKRRDPAGFSV-RTIKEIDLYSFEPWELPCHSEIQSEEEVWYFFCEPCYKNAESKRVRRRTKEGYWKKTGRGSNIKRKY-KTEVIGTKKILSFSRDDAAAEKDKTEWVIHEI-AVENSPD 517
            M + VGFRF PTD +I+ + L  K  +     V   I  +D+ SF+PW+LP HS +++ ++VWYFF     K  +  R  R+TK G+WKKTG   +I RK    E IG K++L F     +    K++W +HE  A  +SP+
Sbjct:    1 MANPVGFRFRPTDGEIVDIYLRPKNLESNTSHVDEVISTVDICSFDPWDLPSHSRMKTRDQVWYFFGRKENKYGKGDRQIRKTKSGFWKKTGVTMDIMRKTGDREKIGEKRVLVFKNHGGS----KSDWAMHEYHATFSSPN 138          
BLAST of FC875267 vs. ExPASy Swiss-Prot
Match: NAC9_ARATH (Putative NAC domain-containing protein 9 OS=Arabidopsis thaliana GN=NAC009 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.658e-18
Identity = 49/135 (36.30%), Postives = 76/135 (56.30%), Query Frame = 2
Query:   92 NQKPMDSLV-GFRFYPTDEQIILLLTMKRRDPAGFSVRTIKEIDLYSFEPWELPCHSEIQSEEEVWYFFCEPCYKNAESKRVRRRTKEGYWKKTGRGSNIKRKYKTEVIGTKKILSFSRDDAAAEKDKTEWVIHE 493
            +QK  D L+ GFRF+PTDE+++     ++      S+  I+++D+Y ++PW+LP  +   + E+ WYF+C    K   S R  R T  G+WK TG    I      + IG KK L F +   AA+  KT+W++HE
Sbjct:    9 DQKMEDVLLPGFRFHPTDEELVSFYLKRKVQHNPLSIELIRQLDIYKYDPWDLPKFA--MTGEKEWYFYCPRDRKYRNSSRPNRVTGAGFWKATGTDRPIYSSEGNKCIGLKKSLVFYK-GRAAKGVKTDWMMHE 140          
BLAST of FC875267 vs. ExPASy Swiss-Prot
Match: NAC98_ARATH (Protein CUP-SHAPED COTYLEDON 2 OS=Arabidopsis thaliana GN=NAC098 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.658e-18
Identity = 49/138 (35.51%), Postives = 74/138 (53.62%), Query Frame = 2
Query:  119 GFRFYPTDEQIILLLTMKRRDPAGFSVRTIKEIDLYSFEPWELPCHSEIQSEEEVWYFFCEPCYKNAESKRVRRRTKEGYWKKTGRGSNIKRKYKTEVIGTKKILSFSRDDAAAEKDKTEWVIHEIAVENSPDFEVLA 532
            GFRF+PTDE++I    +++     FS R I E+DL   EPW+LP  +++  +E  WYFF     K     R  R T+ GYWK TG+   I       ++G KK L F +   A + +K+ WV+HE  +E    +  ++
Sbjct:   20 GFRFHPTDEELITHYLLRKVLDGCFSSRAIAEVDLNKCEPWQLPGRAKMGEKE--WYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIFSSKTCALVGMKKTLVFYK-GRAPKGEKSNWVMHEYRLEGKFSYHFIS 154          
BLAST of FC875267 vs. ExPASy Swiss-Prot
Match: NAC78_ARATH (NAC domain-containing protein 78 OS=Arabidopsis thaliana GN=NAC078 PE=2 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 6.658e-18
Identity = 48/149 (32.21%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  119 GFRFYPTDEQIILLLTMKRRDPAGFSVRTIKEIDLYSFEPWELPCHSEIQSEEEVWYFFCEPCYKNAESKRVRRRTKEGYWKKTGRGSNIKRKYKTEVIGTKKILSFSRDDAAAEKDKTEWVIHEIAVENSPDFEVLASVLELHMCCEI 565
            GFRF+PTDE+++     ++     F    I   D+Y  EPW+LP  S+++S +  WYFF     K +   +  R T++GYWK TG+   I+    + V+G KK L + +   A   ++T WV+HE  + +  D +      E ++ C I
Sbjct:   12 GFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRN--GSRVVGMKKTLVYHK-GRAPRGERTNWVMHEYRLSDE-DLKKAGVPQEAYVLCRI 156          
BLAST of FC875267 vs. ExPASy Swiss-Prot
Match: NAC94_ARATH (Putative NAC domain-containing protein 94 OS=Arabidopsis thaliana GN=ANAC094 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.530e-17
Identity = 49/135 (36.30%), Postives = 72/135 (53.33%), Query Frame = 2
Query:  113 LVGFRFYPTDEQIILLLTMKRRDPAGFSVRTIKEIDLYSFEPWELPCHSEIQSEEEVWYFFCEPCYKNAESKRVRRRTKEGYWKKTGRGSNIKRKYKTEVIGTKKILSFSRDDAAAEKDKTEWVIHEIAVENSPD 517
            L GFRF+PTDE+++     ++          IK++D+Y ++PW+LP  + +  +E  WYF+C    K   S R  R T  G+WK TG    I     T  IG KK L F R   AA+  KT+W++HE  + +  D
Sbjct:   21 LPGFRFHPTDEELVSFYLKRKVLHKSLPFDLIKKVDIYKYDPWDLPKLAAMGEKE--WYFYCPRDRKYRNSTRPNRVTGGGFWKATGTDRPIYSLDSTRCIGLKKSLVFYR-GRAAKGVKTDWMMHEFRLPSLSD 152          
BLAST of FC875267 vs. ExPASy Swiss-Prot
Match: NAC42_ARATH (NAC domain-containing protein 42 OS=Arabidopsis thaliana GN=NAC042 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.316e-17
Identity = 49/151 (32.45%), Postives = 79/151 (52.32%), Query Frame = 2
Query:  113 LVGFRFYPTDEQIILLLTMKRRDPAGFSVRTIKEIDLYSFEPWELPCHSEIQSEEEVWYFFCEPCYKNAESKRVRRRTKEGYWKKTGRGSNIKRKYKTEVIGTKKILSFSRDDAAAEKDKTEWVIHEIAVENSPDFEVLASVLELHMCCEI 565
            L GFRF+PTDE+++     ++ +     +  IK+ID+Y ++PW+LP  S +  +E  WYFFC    K   S R  R T  G+WK TG    +      + +G KK L +    +A +  KT+W++HE  + ++   +  A   E+   C I
Sbjct:   19 LPGFRFHPTDEELLGYYLRRKVENKTIKLELIKQIDIYKYDPWDLPRVSSVGEKE--WYFFCMRGRKYRNSVRPNRVTGSGFWKATGIDKPVYS--NLDCVGLKKSLVYYL-GSAGKGTKTDWMMHEFRLPSTTKTDSPAQQAEVWTLCRI 164          
BLAST of FC875267 vs. ExPASy Swiss-Prot
Match: NAC7_ARATH (NAC domain-containing protein 7 OS=Arabidopsis thaliana GN=NAC007 PE=2 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 5.636e-17
Identity = 49/130 (37.69%), Postives = 70/130 (53.85%), Query Frame = 2
Query:  119 GFRFYPTDEQIILLLTMKRRDPAGFSVRTIKEIDLYSFEPWELPCHSEIQSEEEV-WYFFCEPCYKNAESKRVRRRTKEGYWKKTGRGSNIKRKYKTEVIGTKKILSFSRDDAAAEKDKTEWVIHEIAVE 505
            GFRF+PTDE+++     K+       +  IK+IDLY  EPW+L    +I  EE+  WYFF     K     R  R TK G+WK TGR   I  ++   +IG +K L F +   A    K++W++HE  +E
Sbjct:   10 GFRFHPTDEELVDYYLRKKVASKRIEIDFIKDIDLYKIEPWDLQELCKIGHEEQSDWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIYLRH--SLIGMRKTLVFYK-GRAPNGQKSDWIMHEYRLE 136          
BLAST of FC875267 vs. ExPASy Swiss-Prot
Match: NAC77_ORYSJ (NAC domain-containing protein 77 OS=Oryza sativa subsp. japonica GN=NAC77 PE=2 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 5.636e-17
Identity = 52/139 (37.41%), Postives = 71/139 (51.08%), Query Frame = 2
Query:  119 GFRFYPTDEQIILLLTMKRRDPAGFSVRTIKEIDLYSFEPWELPCHSEIQSEEEVWYFFCEPCYKNAESKRVRRRTKEGYWKKTGRGSNIKRK--------------YKTEVIGTKKILSFSRDDAAAEKDKTEWVIHE 493
            GFRF+PTD ++IL   +++     F+   I E+DL   EPW+LP  S+ +  E+ WYFF     K     R  R TKEGYWK TG+   I R+               K +++G KK L F     A +  KT WV+HE
Sbjct:   22 GFRFHPTDAEVILSYLLQKLLNPSFTSLPIGEVDLNKCEPWDLP--SKAKMGEKEWYFFSHKDMKYPTGMRTNRATKEGYWKATGKDREIFRQPAAVNTSSYGGSSNKKKQLVGMKKTLVFYM-GRAPKGTKTNWVMHE 157          
The following BLAST results are available for this feature:
BLAST of FC875267 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
NAC4_ARATH1.213e-1943.41NAC domain-containing protein 4 OS=Arabidopsis tha... [more]
NAC54_ARATH4.611e-1935.06Protein CUP-SHAPED COTYLEDON 1 OS=Arabidopsis thal... [more]
NAC5_ARATH2.288e-1838.73NAC domain-containing protein 5 OS=Arabidopsis tha... [more]
NAC9_ARATH6.658e-1836.30Putative NAC domain-containing protein 9 OS=Arabid... [more]
NAC98_ARATH6.658e-1835.51Protein CUP-SHAPED COTYLEDON 2 OS=Arabidopsis thal... [more]
NAC78_ARATH6.658e-1832.21NAC domain-containing protein 78 OS=Arabidopsis th... [more]
NAC94_ARATH2.530e-1736.30Putative NAC domain-containing protein 94 OS=Arabi... [more]
NAC42_ARATH4.316e-1732.45NAC domain-containing protein 42 OS=Arabidopsis th... [more]
NAC7_ARATH5.636e-1737.69NAC domain-containing protein 7 OS=Arabidopsis tha... [more]
NAC77_ORYSJ5.636e-1737.41NAC domain-containing protein 77 OS=Oryza sativa s... [more]

Pages

back to top
Libraries
Library NameType
CTVClemen1cdna_library
Properties
Property NameValue
Genbank descriptionC31402A11EF CTVClemen1 Citrus clementina cDNA clone C31402A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875267 ID=FC875267|Name=FC875267|organism=Citrus clementina|type=EST|length=678bp
GACTGGCTCTTTTAAGATTTTGCTGACCAAATTGGAAAGAAGAAGCTCTT
ACTCTCTCATTCTTGTTCTACGTTTCTCCTGCTGGGTGTTGAATCAGAAA
CCAATGGACAGTCTCGTGGGGTTCAGATTCTATCCAACTGATGAACAAAT
TATTCTTCTACTGACGATGAAGAGACGTGACCCTGCAGGTTTCTCCGTCC
GTACGATCAAGGAAATCGATCTCTACAGCTTTGAGCCCTGGGAGCTACCC
TGCCATTCTGAGATTCAGTCTGAGGAAGAAGTGTGGTACTTTTTCTGTGA
ACCTTGTTACAAAAATGCCGAGAGTAAACGGGTACGTAGAAGAACAAAGG
AAGGCTATTGGAAAAAGACTGGCAGAGGTTCTAACATCAAGCGCAAATAC
AAAACTGAGGTGATTGGTACGAAGAAGATTTTGTCTTTTTCCCGCGATGA
TGCTGCTGCCGAGAAAGATAAGACTGAGTGGGTTATACACGAGATAGCTG
TTGAAAATAGCCCTGACTTTGAGGTATTAGCCTCTGTTTTAGAACTGCAT
ATGTGTTGTGAAATTGTCTGTTTATTTTCTTGAAAAATAATTGTAAAATA
CTCTGTTCCTGTTATTGCAGAAGGATTTTGTTGTGTGTCGCCTTGAAAGA
AACGGGAGAAGAGACGCTTGGTGTTGTT
back to top