FC875273

Overview
NameFC875273
Unique NameFC875273
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length682
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8347 contig Ccv1_Contig8347:349..1030. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875273 vs. ExPASy Swiss-Prot
Match: FB76_ARATH (F-box protein At1g67340 OS=Arabidopsis thaliana GN=At1g67340 PE=1 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.587e-75
Identity = 140/214 (65.42%), Postives = 166/214 (77.57%), Query Frame = 2
Query:   32 SCKRLNRVGLRPTVLSQAGPKALAVKAKNWSDSAHRFLKRCVFAGNLEACYTLGMIRFYCLQNRSSGTSLMAKAAMKSHAPALYSLAVIQINGSGGGKNEKDLRAGVALCARAASIGHVDAVRELGHCLQDGYGVRQNIEKGRRLLIEANAREFFQSVSKTRTRHQSYYFQLARATDARIP-----CSPLLSDFGYNVEAPEVHPVNNFLKEWF 658
            +CKRL  + + P VLS+  PKA+AVKA NWS+ +HRFLKRCV AG+LEACYTLGMIRFYCLQNR +G SLMAKAA+ SHAPALYSLAVIQ NGSGG KN+KDLRAGVALCARAA +GHVDA+RELGHCLQDGYGV QN+ +GRR L++ANARE   +V  +  + +S +  L++     +P       PLLSDFG NV APE HP N FL +WF
Sbjct:   75 TCKRLKGLAMNPIVLSRLSPKAIAVKAHNWSEYSHRFLKRCVDAGSLEACYTLGMIRFYCLQNRGNGASLMAKAAISSHAPALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHVDALRELGHCLQDGYGVPQNVSEGRRFLVQANARE-LAAVLSSGIQARSTWLSLSQPPPPVVPNHGQQTCPLLSDFGCNVPAPETHPANRFLADWF 287          
The following BLAST results are available for this feature:
BLAST of FC875273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
FB76_ARATH1.587e-7565.42F-box protein At1g67340 OS=Arabidopsis thaliana GN... [more]
back to top
Libraries
Library NameType
CTVClemen1cdna_library
Properties
Property NameValue
Genbank descriptionC31402B05EF CTVClemen1 Citrus clementina cDNA clone C31402B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875273 ID=FC875273|Name=FC875273|organism=Citrus clementina|type=EST|length=682bp
GAACATAAAACTTATTTCATTTTCTTGGAACAGTTGCAAGAGATTGAACC
GTGTAGGTCTCCGTCCGACGGTCTTGTCACAAGCCGGTCCGAAAGCACTT
GCAGTCAAAGCCAAAAACTGGTCAGATTCTGCGCACCGTTTCCTAAAACG
CTGCGTCTTCGCCGGTAACCTCGAGGCTTGCTATACTCTCGGCATGATCC
GATTTTACTGTTTACAAAACCGTTCGAGCGGAACATCTCTGATGGCCAAG
GCCGCGATGAAGTCGCACGCGCCGGCTCTTTACTCTCTCGCCGTGATACA
GATCAACGGCAGCGGAGGCGGAAAGAACGAGAAAGATCTCCGAGCCGGAG
TCGCACTCTGCGCTCGAGCCGCCTCGATCGGCCACGTGGACGCCGTACGC
GAGCTCGGGCATTGCCTTCAGGACGGCTACGGAGTGCGACAAAACATCGA
GAAGGGACGCCGGTTGCTGATCGAAGCGAATGCACGTGAGTTCTTTCAGT
CCGTATCTAAGACGAGGACACGTCATCAGAGCTATTACTTCCAACTCGCT
CGTGCCACCGATGCGCGGATTCCGTGCAGTCCGTTGTTAAGTGATTTCGG
TTATAATGTGGAGGCGCCAGAGGTGCACCCTGTGAATAATTTTTTGAAAG
AGTGGTTCGAGTCGGGGGTGAGTGAGTTGGGC
back to top