FC875282

Overview
NameFC875282
Unique NameFC875282
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length688
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875282_ssr45 microsatellite FC875282_ssr45:45..60. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10197 contig Ccv1_Contig10197:1..688. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875282 vs. ExPASy Swiss-Prot
Match: ZFP1_WHEAT (Zinc finger protein 1 OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.874e-23
Identity = 73/183 (39.89%), Postives = 86/183 (46.99%), Query Frame = 2
Query:  170 EANLHCLEPWTKRKRSKRPHNPPTEEEYLALCLVMLARGXXXXXXXXXXXXXXXXXQRQKXXXXXXXXXXXXXDQKLVFKCSVCDKAFSSYQALGGHKARHR--KGSGGGDEHXXXXXXXXXXXXXXXGV-----------PNATGRTHECSICHKSFPTGQALGGHKRCHYDGGEKSGVTSS 679
            E + H L+ W KRKRS+R  +   EEE LALCL+ML+RG                 QR +             +    FKCSVC K+FSSYQALGGHK  HR  + S   D                                AT R H CSIC K FPTGQALGGHKR HYDGG  +  +S+
Sbjct:   34 EESGHVLQGWAKRKRSRRQRS---EEENLALCLLMLSRGGK---------------QRVQAPQPESFAAPVPAE----FKCSVCGKSFSSYQALGGHKTSHRVKQPSPPSDAAAAPLVALPAVAAILPSAEPATSSTAASSDGATNRVHRCSICQKEFPTGQALGGHKRKHYDGGVGAAASST 194          
The following BLAST results are available for this feature:
BLAST of FC875282 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
ZFP1_WHEAT1.874e-2339.89Zinc finger protein 1 OS=Triticum aestivum PE=2 SV... [more]
back to top
Libraries
Library NameType
CTVClemen1cdna_library
Properties
Property NameValue
Genbank descriptionC31402C02EF CTVClemen1 Citrus clementina cDNA clone C31402C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875282 ID=FC875282|Name=FC875282|organism=Citrus clementina|type=EST|length=688bp
GAACTCACAACTCACACCTCAAACATTCTGAATCTGAAATTAAGCTCTCT
CTCTCTCTCTCGCTCGCTCTTTCACACTCACTCTTGGTTTTAGATTCAAA
AGAGTAACGGAGATGGCACTGGAAGCTCTCAACTCTCCAACTACTTCGAC
GCCGCCGTTTCACTTCGAAGAAGCTAATCTTCACTGCCTTGAGCCATGGA
CCAAACGCAAGCGCTCAAAGCGTCCACACAATCCTCCAACTGAAGAAGAG
TATCTCGCGCTCTGCCTCGTCATGCTTGCACGTGGCACAACCTCCACCGC
CGCCTTAACTAACTGCAACACGACCACCACCGCCTCACAGCGACAGAAGT
CTCCTGCTCCATCTACTGCTGCAACGACGTCGTCCTCTGACCAGAAGCTT
GTCTTCAAGTGCAGCGTGTGCGACAAGGCGTTTTCTTCTTACCAAGCCTT
GGGTGGTCACAAGGCCCGCCACCGTAAGGGATCTGGGGGCGGCGACGAAC
ACTCCGCTTCCACTACCACCAACACCAACGCAACCGCCACGACCACCGGC
GTACCGAACGCCACTGGTAGGACCCACGAGTGTTCCATCTGTCACAAGTC
CTTCCCCACCGGCCAAGCCTTGGGCGGACACAAACGTTGTCACTACGATG
GCGGCGAGAAGAGCGGAGTGACGTCATCCGGGTCCAGT
back to top