FC876158

Overview
NameFC876158
Unique NameFC876158
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length684
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15114 contig Ccv1_Contig15114:12..696. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876158 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 2.510e-105
Identity = 195/201 (97.01%), Postives = 196/201 (97.51%), Query Frame = 2
Query:   80 MAAMASTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLSGQLFSAMVVRKPAHIFLDELGIDYDEQDSYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG 682
            MAAMASTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWL GQLFSAMVVRKPAHIFLDELGIDYDEQD+YVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG
Sbjct:    1 MAAMASTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG 201          
BLAST of FC876158 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 5.455e-76
Identity = 141/179 (78.77%), Postives = 158/179 (88.27%), Query Frame = 2
Query:  146 SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLSGQLFSAMVVRKPAHIFLDELGIDYDEQDSYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG 682
            SSF+G P++PS +R+QP K+    ++S+S + SPPYDL  F FDPIKESIVSREMTRRYM DMITYADTD    GAGS+GL C YELSKNP++Q+AIIEQSVSPGGGAWL GQLFS MVVRKPAH+FLDELGI+YDEQD+YVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG
Sbjct:   20 SSFYGTPLAPSSIRVQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSSGLVC-YELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSGMVVRKPAHLFLDELGIEYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG 197          
BLAST of FC876158 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.029e-74
Identity = 147/202 (72.77%), Postives = 170/202 (84.16%), Query Frame = 2
Query:   80 MAAMASTAFAPSVSSTT-NKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLSGQLFSAMVVRKPAHIFLDELGIDYDEQDSYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG 682
            MAA+AST    S+SST   +LFDSSFHG+ +S + + +      +P + S+ A+ +  YDLN F FDPIKESIVSREMTRRYMTDMITYA+TD    GAGSAGLS AYE+SKNPN+Q+AIIEQSVSPGGGAWL GQLFSAM+VRKPAH+FLDE+G+ YDEQD+YVV+KHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG
Sbjct:    1 MAAIASTL---SLSSTKPQRLFDSSFHGSAISAAPISI----GLKPRSFSVRATTAG-YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG 194          
BLAST of FC876158 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 6.045e-67
Identity = 135/199 (67.84%), Postives = 154/199 (77.39%), Query Frame = 2
Query:  119 SSTTNKLFDSSFHGAPMSPSLLRLQPIK----------SSRPNNLSISASAS-PPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLSGQLFSAMVVRKPAHIFLDELGIDYDEQDSYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG 682
            ++  + L  SSF G+ + P+  R  P             + P   S+S S+S PPYDL +F+F PIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSK+P + IAI+EQSVSPGGGAWL GQLFSAMVVRKPAH+FLDELG+ YDE + YVVIKHAALFTST+MS LLARPNVKLFNAVA EDLIV+G
Sbjct:    3 TAAASSLLKSSFAGSRL-PAATRTTPASLVVATGPRGAGAGPICASMSMSSSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPAVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHAALFTSTVMSLLLARPNVKLFNAVAVEDLIVRG 200          
BLAST of FC876158 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 3.918e-66
Identity = 131/196 (66.84%), Postives = 152/196 (77.55%), Query Frame = 2
Query:  119 SSTTNKLFDSSFHGAPMSPSLLRLQ---------PIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLSGQLFSAMVVRKPAHIFLDELGIDYDEQDSYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVK 679
            ++  + L  SSF G+ + PS  R           P     P   SIS S +PPYDL +F+F PIKESIVSREMTRRYMTDMIT+ADTD    GAGSAGLSCAYELSK+P + +AI+EQSVSPGGGAWL GQLFSAMVVR+PAH+FLDELG+ YDE + YVV+KHAALFTST+MS+LLARPNVKLFNAVA EDLIV+
Sbjct:    3 TTAASSLLKSSFAGSRL-PSATRTTTPSSVAVATPRAGGGPIRASIS-SPNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYDEAEDYVVVKHAALFTSTVMSRLLARPNVKLFNAVAVEDLIVR 196          
BLAST of FC876158 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 188.348 bits (477), Expect = 3.119e-47
Identity = 94/151 (62.25%), Postives = 121/151 (80.13%), Query Frame = 2
Query:  233 ASASPPYDLN-TFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQSVSPGGGAWLSGQLFSAMVVRKPAHIFLDELGIDYDEQDSYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVK 679
            + A P Y L+ +F F PI+ES VSR MTRRY +D+  YA++D    GAGSAGL+ AY + ++ P+++IAIIE SV+PGGGAWL GQLFSAMVVRKPA +FL+E+G+ Y+++  YVV+KHAALFTST+M++ LA PNVKLFNA A EDLIVK
Sbjct:   37 SKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYYIGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYEDEGDYVVVKHAALFTSTVMARTLALPNVKLFNATAVEDLIVK 187          
BLAST of FC876158 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 180.644 bits (457), Expect = 6.504e-45
Identity = 90/139 (64.75%), Postives = 109/139 (78.42%), Query Frame = 2
Query:  266 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQSVSPGGGAWLSGQLFSAMVVRKPAHIFLDELGIDYDEQDSYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVK 679
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L K  P+++IAIIE SVSPGGGAWL GQLFSAM++RKPA  FL E+G+ Y+++ +YVV+KHAALFTSTIMSK+L  PN+KLFNA   EDLI +
Sbjct:   44 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQMPNIKLFNATCVEDLITR 182          
BLAST of FC876158 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.892e-44
Identity = 90/168 (53.57%), Postives = 120/168 (71.43%), Query Frame = 2
Query:  188 LQPIKSSRPNNLSISASA---SPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQSVSPGGGAWLSGQLFSAMVVRKPAHIFLDELGIDYDEQDSYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVK 679
            + P+KS + +N +++  A    P  +L   KF PIKE  V R M RRY  DM   A +D    GAGSAGLSCAY L +  P+++I I+E +V+PGGG WL GQL SAMV RKPA  FLD++G+ Y+++ ++VV+KHAALFTST++SK+LA PNVK+FNA A EDLI+K
Sbjct:   24 MDPLKSKQQSNATVNKPAFKPEPAVNLTPIKFAPIKEHQVQRAMVRRYFQDMEERAISDVIIVGAGSAGLSCAYALGTARPDLKITILESNVAPGGGCWLGGQLMSAMVCRKPADEFLDQVGVPYEDEGNFVVVKHAALFTSTVLSKVLAMPNVKMFNATACEDLIIK 191          
BLAST of FC876158 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 1.892e-44
Identity = 91/141 (64.54%), Postives = 113/141 (80.14%), Query Frame = 2
Query:  266 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSK-NPNIQIAIIEQSVSPGGGAWLSGQLFSAMVVRKPAHIFLDELGIDYDE--QDSYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVK 679
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L+K  P+++IAI+E SVSPGGGAWL GQLFSAMV+R+PA +FL+ELG+ Y+E    +YVV+KHA+LFTST+MSK+L+ PNVKLFNA A EDLI +
Sbjct:   48 FKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDANPNYVVVKHASLFTSTLMSKVLSFPNVKLFNATAVEDLITR 188          
BLAST of FC876158 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.391e-44
Identity = 90/139 (64.75%), Postives = 107/139 (76.98%), Query Frame = 2
Query:  266 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQSVSPGGGAWLSGQLFSAMVVRKPAHIFLDELGIDYDEQDSYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVK 679
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS  Y L K  P+++IAIIE SVSPGGGAWL GQLFSAMV+RKPA  FL E+G+ Y+++ +YVV+KHAALFTSTIMSK+L  PN KLFNA   EDLI +
Sbjct:   48 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIVGAGSCGLSTRYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQLPNCKLFNATCVEDLITR 186          
The following BLAST results are available for this feature:
BLAST of FC876158 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
THI4_CITSI2.510e-10597.01Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL5.455e-7678.77Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH1.029e-7472.77Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE6.045e-6767.84Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE3.918e-6666.84Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI2_SCHPO3.119e-4762.25Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]
THI4_FUSOX6.504e-4564.75Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_UROFA1.892e-4453.57Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]
THI4_ASPOR1.892e-4464.54Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]
THI4_FUSSH9.391e-4464.75Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]

Pages

back to top
Libraries
Library NameType
DevOvary1cdna_library
Properties
Property NameValue
Genbank descriptionC32001A01EF DevOvary1 Citrus clementina cDNA clone C32001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876158 ID=FC876158|Name=FC876158|organism=Citrus clementina|type=EST|length=684bp
TCATCACTGCTGCAAATCAAATTACTTCTCATTATCAAACTTCTAAGCAG
CAGGGGAAGGAGGGGTAAAAAAAAAAAACATGGCAGCCATGGCTTCTACA
GCTTTCGCTCCTTCAGTTTCGTCTACCACCAATAAGCTCTTTGACTCATC
CTTTCATGGGGCTCCCATGTCACCTTCTCTTCTACGTCTTCAACCCATCA
AATCTTCTCGTCCCAACAACTTGTCCATTTCTGCTTCTGCTTCTCCTCCT
TATGACTTGAACACTTTCAAGTTTGACCCCATCAAAGAATCCATTGTTTC
TCGTGAAATGACGCGCAGGTACATGACGGACATGATCACTTATGCTGACA
CTGATGTGGTAGTGGTTGGTGCTGGCTCTGCTGGCCTCTCTTGTGCTTAT
GAGCTCAGCAAAAACCCCAACATTCAGATTGCTATTATCGAACAGTCTGT
TAGCCCCGGCGGTGGCGCGTGGCTCAGTGGACAGCTCTTCTCTGCCATGG
TTGTGCGCAAACCAGCCCACATCTTCCTTGACGAGCTTGGCATCGACTAC
GATGAGCAAGACAGCTATGTTGTGATCAAGCATGCAGCGCTGTTCACCTC
CACTATAATGAGCAAGCTCCTGGCCCGCCCCAACGTCAAGCTCTTTAATG
CAGTGGCAGCCGAAGACTTGATAGTCAAAGGCGG
back to top