FC876163

Overview
NameFC876163
Unique NameFC876163
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10294 contig Ccv1_Contig10294:1..709. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876163 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.237e-59
Identity = 120/212 (56.60%), Postives = 144/212 (67.92%), Query Frame = 1
Query:  106 GSAGNCG---SGVVCPGGECCSRFGWCGLTIDHCC--DGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTG--GWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR-GK-YYGRGPIQLTWKLHYLRCGEGLGRGEDLLKHPDLLA 708
            GSA  CG    G +CPGG CCS+FGWCG T D+C   +GCQS C+           G+ GD G L  +I+RE F+ +L +RND  CPAR FYTYDAFI AAK+FPAF  +G++  RKRE+AAF AQT HETTG  GW  AP G Y WGYC+NRE+  A  DYC  DPNYPC  GK Y+GRGP+QLTW  +Y +CG  +  G DLL +PDLLA
Sbjct:   19 GSAEQCGRQAGGALCPGGLCCSQFGWCGNTDDYCKKENGCQSQCS-----------GSGGDTGGLDSLITRERFDQMLLHRNDGGCPARGFYTYDAFIAAAKSFPAFATTGDDATRKREVAAFLAQTSHETTGGAGWA-APDGPYTWGYCYNRELNPA--DYCQWDPNYPCAPGKQYFGRGPMQLTWNYNYGQCGRAI--GVDLLNNPDLLA 214          
BLAST of FC876163 vs. ExPASy Swiss-Prot
Match: CHI6_POPTR (Acidic endochitinase WIN6 OS=Populus trichocarpa GN=WIN6 PE=2 SV=2)

HSP 1 Score: 226.483 bits (576), Expect = 1.110e-58
Identity = 117/214 (54.67%), Postives = 140/214 (65.42%), Query Frame = 1
Query:  106 GSAGNCG---SGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGE-----CDPDDGTAGDG--GELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDP--NYPC-RGKYY-GRGPIQLTWKLHYLRCGEGLGRGEDLLKHPDLL 705
            GSA  CG      +CPGG CCS +GWCG T+D+C  GCQS C+    G+     CD  D   GDG  G L  II +  F+ LL++RND RCPA  FYTY+AFI AAK FP FGN+G++ MRKREIAAF  QT HETTGGWPDAP G YAWGYC+ +E+      YCDP  NY C  GK Y GRGPIQL+W  +Y  CG+ L     LL+ P+L+
Sbjct:   20 GSAEQCGRQAGDALCPGGLCCSSYGWCGTTVDYCGIGCQSQCDGGGGGDGGDDGCDGGDDGGGDGDDGYLSDIIPKSKFDALLKFRNDARCPAAGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETTGGWPDAPCGPYAWGYCYLKEINC--QPYCDPSSNYQCVAGKQYCGRGPIQLSWNYNYGLCGDDLKL--PLLQEPELV 229          
BLAST of FC876163 vs. ExPASy Swiss-Prot
Match: CHIB_VITVI (Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.450e-58
Identity = 110/208 (52.88%), Postives = 140/208 (67.31%), Query Frame = 1
Query:  106 GSAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCRG--KYYGRGPIQLTWKLHYLRCGEGLGRGEDLLKHPDLLA 708
            GSA  CG    G VCPGG CCS+FGWCG T D+C  GCQS C+                 G++G++I+R MF D+L++RN+  CP + FYTYDAFI AAKAFP FG +G+ T RKREIAAF AQT HETTGGW  AP G YAWGYC+ RE G+  + YC P+  +PC    KYYGRGPIQ+++  +Y + G+ +  G DL+ +PDL+A
Sbjct:   18 GSAEQCGGQAGGRVCPGGACCSKFGWCGNTADYCGSGCQSQCSST---------------GDIGQLITRSMFNDMLKHRNEGSCPGKGFYTYDAFIAAAKAFPGFGTTGDTTTRKREIAAFLAQTSHETTGGWASAPDGPYAWGYCYLREQGSPGA-YCVPSAQWPCAAGRKYYGRGPIQISYNYNYGQAGKAI--GVDLVNNPDLVA 207          
BLAST of FC876163 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 9.400e-58
Identity = 119/211 (56.40%), Postives = 141/211 (66.82%), Query Frame = 1
Query:  106 GSAGNCG---SGVVCPGGECCSRFGWCGLTIDHCC-DGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTG--GWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR-GK-YYGRGPIQLTWKLHYLRCGEGLGRGEDLLKHPDLLA 708
            GSA  CG    G +CPGG CCS+FGWCG T D+C   GCQS C+           G A   G L  +ISRE F  +L +RND  CPAR FYTYDAFI AA++FPAF  +G++  RKREIAAF AQT HETTG  GW  AP G YAWGYC+NRE+   SS YC  DPNYPC  GK Y+GRGP+QL+W  +Y +CG  +  G DLL +PDLL+
Sbjct:   20 GSAEQCGRQAGGALCPGGLCCSQFGWCGSTADYCTVPGCQSQCS---------GSGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSS-YCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAI--GVDLLNNPDLLS 217          
BLAST of FC876163 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.228e-57
Identity = 109/208 (52.40%), Postives = 134/208 (64.42%), Query Frame = 1
Query:  103 GGSAGN-CG---SGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCR--GKYYGRGPIQLTWKLHYLRCGEGLGRGEDLLKHPDLLA 708
            GGS G  CG    G +CPGG CCS+FGWCG T D+C  GCQS C            G +    +L  +ISR  F+ +L++RND  CPA+ FYTYDAFI AAKA+P+FGN+G+   RKREIAAF  QT HETTGGW  AP G YAWGYCF RE   ++     P +PC    +YYGRGPIQ++W  +Y +CG  +  G DLL  PDL+A
Sbjct:   23 GGSYGEQCGRQAGGALCPGGNCCSQFGWCGSTTDYCGPGCQSQCG-----------GPSPAPTDLSALISRSTFDQMLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPSTYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQCGRAI--GVDLLNKPDLVA 217          
BLAST of FC876163 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 220.705 bits (561), Expect = 6.093e-57
Identity = 105/205 (51.22%), Postives = 134/205 (65.37%), Query Frame = 1
Query:  109 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRG--KYYGRGPIQLTWKLHYLRCGEGLGRGEDLLKHPDLLA 708
            SA  CG+   G +CPGG CCS+FGWCG T ++C DGCQS C+           G++G GG L  +IS + F ++L++RND  C  + FYTYDAF+ AAKAFP F N G+   +KREIAAF  QT HETTGGWP AP G YAWGYCF RE   ++       +PC    +YYGRGPIQ++W  +Y +CG  +  G DLL +PDL+A
Sbjct:   19 SAEQCGTQAGGALCPGGLCCSKFGWCGSTSEYCGDGCQSQCS-----------GSSG-GGTLSSLISGDTFNNMLKHRNDNACQGKPFYTYDAFLSAAKAFPNFANKGDTATKKREIAAFLGQTSHETTGGWPTAPDGPYAWGYCFLREQNPSTYCQASSEFPCASGKQYYGRGPIQISWNYNYGQCGRAI--GVDLLNNPDLVA 209          
BLAST of FC876163 vs. ExPASy Swiss-Prot
Match: CHI5_PHAVU (Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.039e-56
Identity = 108/208 (51.92%), Postives = 133/208 (63.94%), Query Frame = 1
Query:  103 GGSAGN-CG---SGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCR--GKYYGRGPIQLTWKLHYLRCGEGLGRGEDLLKHPDLLA 708
            GGS G  CG    G +CPGG CCS+FGWCG T D+C   CQS C            G +    +L  +ISR  F+ +L++RND  CPA+ FYTYDAFI AAKA+P+FGN+G+   RKREIAAF  QT HETTGGW  AP G YAWGYCF RE   ++     P +PC    +YYGRGPIQ++W  +Y +CG  +  G DLL  PDL+A
Sbjct:   22 GGSYGEQCGRQAGGALCPGGNCCSQFGWCGSTTDYCGKDCQSQCG-----------GPSPAPTDLSALISRSTFDQVLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPSAYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQCGRAI--GVDLLNKPDLVA 216          
BLAST of FC876163 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 219.55 bits (558), Expect = 1.357e-56
Identity = 115/205 (56.10%), Postives = 137/205 (66.83%), Query Frame = 1
Query:  115 GNCGSGVVCPGGECCSRFGWCGLTIDHCC-DGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTG--GWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR-GK-YYGRGPIQLTWKLHYLRCGEGLGRGEDLLKHPDLLA 708
            G    G +CPGG CCS+FGWCG T D+C   GCQS C+           G A   G L  +ISRE F  +L +RND  CPAR FYTYDAFI AA++FPAF  +G++  RKREIAAF AQT HETTG  GW  AP G YAWGYC+NRE+   SS YC  DPNYPC  GK Y+GRGP+QL+W  +Y +CG  +  G DLL +PDLL+
Sbjct:    4 GRQAGGALCPGGLCCSQFGWCGSTADYCTVPGCQSQCS---------GSGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSS-YCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAI--GVDLLNNPDLLS 195          
BLAST of FC876163 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 219.164 bits (557), Expect = 1.773e-56
Identity = 109/208 (52.40%), Postives = 135/208 (64.90%), Query Frame = 1
Query:  109 SAGNCG---SGVVCPGGECCSRFGWCGLTIDHCCD-GCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCRG--KYYGRGPIQLTWKLHYLRCGEGLGRGEDLLKHPDLLA 708
            SA  CG    G +CP G CCS FGWCG T  +C   GCQS        +C P     G  G+L  IIS   F+D+L++RND  CPAR FYTY+AFI AAK+FP FG +G+   RK+E+AAFF QT HETTGGW  AP G Y+WGYCF +E   A SDYC+P+  +PC    +YYGRGP+QL+W  +Y  CG  +  G DLL +PDL+A
Sbjct:   32 SAEQCGRQAGGALCPNGLCCSEFGWCGNTEPYCKQPGCQS--------QCTPGGTPPGPTGDLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPA-SDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLCGRAI--GVDLLNNPDLVA 228          
BLAST of FC876163 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 3.024e-56
Identity = 113/208 (54.33%), Postives = 137/208 (65.87%), Query Frame = 1
Query:  109 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHYLRCGEGLGRGEDLLKHPDLLA 708
            SA  CGS   G  CP G CCS+FGWCG T D+C  G CQS C     G   P   T   GG+LG IIS  MF+ +L++RND  C  + FY+Y+AFI AA++FP FG SG+ T RKREIAAFFAQT HETTGGW  AP G YAWGYC+ RE G +  DYC P+  +PC    KY+GRGPIQ++   +Y  CG  +  G DLL +PDL+A
Sbjct:   22 SAEQCGSQAGGARCPSGLCCSKFGWCGNTNDYCGPGNCQSQCP----GGPTPTPPTPPGGGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQG-SPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAI--GVDLLNNPDLVA 222          
The following BLAST results are available for this feature:
BLAST of FC876163 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI1_THECC2.237e-5956.60Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHI6_POPTR1.110e-5854.67Acidic endochitinase WIN6 OS=Populus trichocarpa G... [more]
CHIB_VITVI1.450e-5852.88Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE... [more]
CHI1_GOSHI9.400e-5856.40Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHIT_PHAVU1.228e-5752.40Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]
CHI2_PEA6.093e-5751.22Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHI5_PHAVU1.039e-5651.92Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1[more]
CHI2_GOSHI1.357e-5656.10Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHIB_ARATH1.773e-5652.40Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI1_TOBAC3.024e-5654.33Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]

Pages

back to top
Libraries
Library NameType
DevOvary1cdna_library
Properties
Property NameValue
Genbank descriptionC32001A08EF DevOvary1 Citrus clementina cDNA clone C32001A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876163 ID=FC876163|Name=FC876163|organism=Citrus clementina|type=EST|length=713bp
CTCGCCGGGGAAGCAGAGGATAATTGATATCATAACTGTTGCTTTCAAAT
GAGGCTTATTGCGTCCTTACTAATTTTCTCTCTGGTTTTATCTTTTGTAC
TAGGAGGCTCAGCAGGGAACTGTGGAAGCGGCGTTGTGTGCCCAGGAGGG
GAGTGTTGTAGTCGATTTGGTTGGTGTGGCCTAACAATAGACCACTGTTG
TGACGGCTGCCAAAGTAACTGTAATCAGGTTGTTTGCGGTGAATGTGATC
CCGACGACGGGACGGCTGGTGATGGCGGTGAACTGGGCAAGATCATCTCA
AGGGAGATGTTTGAAGACTTGCTTGAGTATAGAAATGATAAACGATGCCC
TGCCAGATGCTTCTACACTTATGATGCTTTTATAGAGGCAGCCAAAGCTT
TTCCAGCCTTTGGTAACTCTGGAAATGAAACCATGCGTAAAAGAGAAATT
GCTGCCTTTTTTGCCCAAACTGGCCATGAAACTACTGGGGGATGGCCCGA
TGCACCTGGTGGCGAATATGCTTGGGGATATTGCTTTAATAGGGAAGTTG
GCGCTGCGTCGTCCGACTACTGTGATCCTAACTATCCATGTCGAGGGAAG
TACTATGGCCGAGGTCCAATTCAACTCACTTGGAAATTACATTACTTACG
GTGCGGAGAAGGCCTAGGGCGAGGAGAGGACTTGTTGAAACATCCAGACC
TTCTTGCTNACTA
back to top