FC876168

Overview
NameFC876168
Unique NameFC876168
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length720
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10301 contig Ccv1_Contig10301:1..720. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876168 vs. ExPASy Swiss-Prot
Match: MYB12_ARATH (Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 3.173e-61
Identity = 112/167 (67.07%), Postives = 134/167 (80.24%), Query Frame = 3
Query:  165 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFWRP---SSEKTLPVKVDVAAAGTGVASDRKAGKKIGSAIMKNKSHSKK 656
            MGRAPCCEKVG+K+GRWTAEED IL+ YIQ+NGEGSWRSLPKNAGL RCGKSCRLRWINYLR+DLKRGNIT EEEE+++KLH++LGNRWSLIA ++PGRTDNEIKNYWNSHLSRK+H F R    S + +  +  + ++A     + R+ G+   SA MK K H  K
Sbjct:    1 MGRAPCCEKVGIKRGRWTAEEDQILSNYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINYLRSDLKRGNITPEEEELVVKLHSTLGNRWSLIAGHLPGRTDNEIKNYWNSHLSRKLHNFIRKPSISQDVSAVIMTNASSAPPPPQAKRRLGRTSRSA-MKPKIHRTK 166          
BLAST of FC876168 vs. ExPASy Swiss-Prot
Match: MYBP_MAIZE (Myb-related protein P OS=Zea mays GN=P PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.970e-59
Identity = 108/164 (65.85%), Postives = 128/164 (78.05%), Query Frame = 3
Query:  165 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKIHTFWRPSSEKTLPVKVDVAAAGTGVASDRKAGKKIGSAIMKNKSHSKK 656
            MGR PCCEKVGLK+GRWTAEED +L  YI  +GEGSWRSLPKNAGLLRCGKSCRLRWINYLRAD+KRGNI+ EEE+IIIKLHA+LGNRWSLIAS++PGRTDNEIKNYWNSHLSR+IHT+ R  +       + +  +    A  R+ G+  G     + S +K+
Sbjct:    1 MGRTPCCEKVGLKRGRWTAEEDQLLANYIAEHGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADVKRGNISKEEEDIIIKLHATLGNRWSLIASHLPGRTDNEIKNYWNSHLSRQIHTYRRKYTAGPDDTAIAIDMSKLQSADRRRGGRTPGRPPKASASRTKQ 164          
BLAST of FC876168 vs. ExPASy Swiss-Prot
Match: MYB1_HORVU (Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.133e-49
Identity = 87/116 (75.00%), Postives = 99/116 (85.34%), Query Frame = 3
Query:  165 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 512
            MGR+PCCEK    KG WT EEDD LT YI+A+GEG WRSLPK AGLLRCGKSCRLRWINYLR DLKRGN + EE+E+IIKLH+ LGN+WSLIA  +PGRTDNEIKNYWN+H+ RK+
Sbjct:    1 MGRSPCCEKAHTNKGAWTKEEDDRLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFSHEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKL 116          
BLAST of FC876168 vs. ExPASy Swiss-Prot
Match: MYB08_ANTMA (Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.133e-49
Identity = 87/116 (75.00%), Postives = 98/116 (84.48%), Query Frame = 3
Query:  165 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 512
            MGR+PCCEK    KG WT EEDD L  YI+A+GEG WRSLPK AGLLRCGKSCRLRWINYLR DLKRGN T EE+E+IIKLH+ LGN+WSLIA  +PGRTDNEIKNYWN+H+ RK+
Sbjct:    1 MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKL 116          
BLAST of FC876168 vs. ExPASy Swiss-Prot
Match: MYB4_ARATH (Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 6.207e-49
Identity = 86/116 (74.14%), Postives = 98/116 (84.48%), Query Frame = 3
Query:  165 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 512
            MGR+PCCEK    KG WT EED+ L  YI+A+GEG WRSLPK AGLLRCGKSCRLRWINYLR DLKRGN T EE+E+IIKLH+ LGN+WSLIA  +PGRTDNEIKNYWN+H+ RK+
Sbjct:    1 MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKL 116          
BLAST of FC876168 vs. ExPASy Swiss-Prot
Match: MYB30_ANTMA (Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 8.106e-49
Identity = 87/116 (75.00%), Postives = 97/116 (83.62%), Query Frame = 3
Query:  165 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 512
            MGR+PCCEK    KG WT EED  L  YI+A+GEG WRSLPK AGLLRCGKSCRLRWINYLR DLKRGN T EE+EIIIKLH+ LGN+WSLIA  +PGRTDNEIKNYWN+H+ RK+
Sbjct:    1 MGRSPCCEKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDEIIIKLHSLLGNKWSLIAGALPGRTDNEIKNYWNTHIKRKL 116          
BLAST of FC876168 vs. ExPASy Swiss-Prot
Match: MYB38_MAIZE (Myb-related protein Zm38 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.358e-48
Identity = 83/116 (71.55%), Postives = 100/116 (86.21%), Query Frame = 3
Query:  165 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 512
            MGR+PCCEK    +G WT EED+ L  YI+A+GEG WRSLPK AGLLRCGKSCRLRWINYLR DLKRGN TA+E+++I+KLH+ LGN+WSLIA+ +PGRTDNEIKNYWN+H+ RK+
Sbjct:    1 MGRSPCCEKAHTNRGAWTKEEDERLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHVRRKL 116          
BLAST of FC876168 vs. ExPASy Swiss-Prot
Match: MYB32_ARATH (Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 4.023e-48
Identity = 84/116 (72.41%), Postives = 99/116 (85.34%), Query Frame = 3
Query:  165 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 512
            MGR+PCCEK    KG WT EEDD L  YI+A+GEG WRSLP++AGL RCGKSCRLRWINYLR DLKRGN T EE+++IIKLH+ LGN+WSLIA+ +PGRTDNEIKNYWN+H+ RK+
Sbjct:    1 MGRSPCCEKDHTNKGAWTKEEDDKLISYIKAHGEGCWRSLPRSAGLQRCGKSCRLRWINYLRPDLKRGNFTLEEDDLIIKLHSLLGNKWSLIATRLPGRTDNEIKNYWNTHVKRKL 116          
BLAST of FC876168 vs. ExPASy Swiss-Prot
Match: MYB6_ARATH (Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 6.862e-48
Identity = 84/116 (72.41%), Postives = 97/116 (83.62%), Query Frame = 3
Query:  165 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 512
            MGR+PCCEK    KG WT EED  L  YI+ +GEG WRSLPK+AGLLRCGKSCRLRWINYLR DLKRGN T +E++IIIKLH+ LGN+WSLIA  +PGRTDNEIKNYWN+H+ RK+
Sbjct:    1 MGRSPCCEKAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINYLRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKL 116          
BLAST of FC876168 vs. ExPASy Swiss-Prot
Match: MYB3_ARATH (Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 8.962e-48
Identity = 82/116 (70.69%), Postives = 97/116 (83.62%), Query Frame = 3
Query:  165 MGRAPCCEKVGLKKGRWTAEEDDILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEEIIIKLHASLGNRWSLIASNMPGRTDNEIKNYWNSHLSRKI 512
            MGR+PCCEK  + KG WT EED +L  YI+ +GEG WRSLP+ AGL RCGKSCRLRW+NYLR DLKRGN T EE+E+IIKLH+ LGN+WSLIA  +PGRTDNEIKNYWN+H+ RK+
Sbjct:    1 MGRSPCCEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKL 116          
The following BLAST results are available for this feature:
BLAST of FC876168 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
MYB12_ARATH3.173e-6167.07Transcription factor MYB12 OS=Arabidopsis thaliana... [more]
MYBP_MAIZE2.970e-5965.85Myb-related protein P OS=Zea mays GN=P PE=2 SV=1[more]
MYB1_HORVU2.133e-4975.00Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1... [more]
MYB08_ANTMA2.133e-4975.00Myb-related protein 308 OS=Antirrhinum majus GN=MY... [more]
MYB4_ARATH6.207e-4974.14Transcription repressor MYB4 OS=Arabidopsis thalia... [more]
MYB30_ANTMA8.106e-4975.00Myb-related protein 330 OS=Antirrhinum majus GN=MY... [more]
MYB38_MAIZE2.358e-4871.55Myb-related protein Zm38 OS=Zea mays PE=2 SV=1[more]
MYB32_ARATH4.023e-4872.41Transcription factor MYB32 OS=Arabidopsis thaliana... [more]
MYB6_ARATH6.862e-4872.41Transcription repressor MYB6 OS=Arabidopsis thalia... [more]
MYB3_ARATH8.962e-4870.69Transcription factor MYB3 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Libraries
Library NameType
DevOvary1cdna_library
Properties
Property NameValue
Genbank descriptionC32001B04EF DevOvary1 Citrus clementina cDNA clone C32001B04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876168 ID=FC876168|Name=FC876168|organism=Citrus clementina|type=EST|length=720bp
GGCTCACAGTCCACTCCAAGAGCCAAGCAAAATACAAGCTCTGTTCACTC
ACCATCCCTTTTCCATCCACTTGCAAACACTTGTACGGGGGCTTTGTTAA
TATAACTAAATATATACGATTACATTTCGTTCTGTTTGAGAGCGTGGATG
CGTACTTAAGAGGAATGGGGAGAGCTCCGTGTTGCGAGAAAGTGGGTCTA
AAGAAGGGGAGATGGACGGCTGAAGAGGATGACATATTGACCAAGTATAT
TCAAGCTAACGGAGAAGGGTCATGGAGGTCACTGCCCAAGAATGCTGGGT
TGCTGAGGTGTGGGAAGAGTTGCAGATTGCGGTGGATCAATTACTTGAGA
GCTGACTTGAAGAGAGGTAACATTACTGCTGAAGAGGAAGAGATCATCAT
TAAGTTGCATGCATCTTTGGGTAACAGGTGGTCTTTAATTGCAAGCAATA
TGCCAGGTAGAACAGATAACGAGATAAAGAACTACTGGAACTCGCATTTG
AGCAGAAAAATTCACACCTTCTGGAGGCCATCTAGTGAAAAAACACTACC
AGTGAAGGTGGACGTGGCCGCCGCCGGCACAGGCGTTGCATCGGATAGGA
AAGCTGGCAAAAAAATTGGATCGGCAATTATGAAAAACAAAAGCCACAGT
AAGAAAGATGGTAATATTAATATCGGAACCCGAAGAATTGTTGCCAANGA
TGGTAATATTAATATCGGAA
back to top