FC876172

Overview
NameFC876172
Unique NameFC876172
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length740
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15072 contig Ccv1_Contig15072:93..833. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876172 vs. ExPASy Swiss-Prot
Match: G3P2_AGABI (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agaricus bisporus GN=gpd2 PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 6.378e-28
Identity = 65/122 (53.28%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFXXXXXXXXXXXGGAKGGYISSIS 732
            KVGINGFGRIGR+                NDPFID +YMAYMFKYDS HG FKGT+ V + S + ++G+ +KVF++RDPA IPWG  G DYVVES+GVF           GGAK   IS+ S
Sbjct:    3 KVGINGFGRIGRIVLRNALQFQDIEVVAVNDPFIDLEYMAYMFKYDSVHGRFKGTVEVKNGSFV-VDGRPMKVFAERDPAAIPWGSVGADYVVESTGVFTTIDKASAHLKGGAKKVVISAPS 123          
BLAST of FC876172 vs. ExPASy Swiss-Prot
Match: G3P_CRYCU (Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus curvatus GN=GPD PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.421e-27
Identity = 67/123 (54.47%), Postives = 72/123 (58.54%), Query Frame = 1
Query:  364 TKVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFXXXXXXXXXXXGGAKGGYISSIS 732
            TKVGINGFGRIGR+                NDPFID  YM YMFKYDSTHG FKG +    D  L I GK I VF +RDPA IPWG  G DYVVES+GVF           GGAK   IS+ S
Sbjct:    3 TKVGINGFGRIGRIVLRNALEHGDIDVVAINDPFIDLDYMVYMFKYDSTHGRFKGKVET-KDGKLVIEGKPISVFGERDPAAIPWGKAGADYVVESTGVFTTIEKASLHLKGGAKKVIISAPS 124          
BLAST of FC876172 vs. ExPASy Swiss-Prot
Match: G3P_CRIGR (Glyceraldehyde-3-phosphate dehydrogenase OS=Cricetulus griseus GN=GAPDH PE=2 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 1.421e-27
Identity = 64/122 (52.46%), Postives = 74/122 (60.66%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFXXXXXXXXXXXGGAKGGYISSIS 732
            KVG+NGFGRIGRL                NDPFID  YM YMF+YDSTHG FKGT+   ++  L INGK I +F +RDPA I WGD G +YVVES+GVF           GGAK   IS+ S
Sbjct:    3 KVGVNGFGRIGRLVTRAAFTSGKVEVVAINDPFIDLNYMVYMFQYDSTHGKFKGTVKA-ENGKLVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPS 123          
BLAST of FC876172 vs. ExPASy Swiss-Prot
Match: G3P_PARBA (Glyceraldehyde-3-phosphate dehydrogenase OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=GPD PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.424e-27
Identity = 63/122 (51.64%), Postives = 72/122 (59.02%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFXXXXXXXXXXXGGAKGGYISSIS 732
            KVGINGFGRIGR+                NDPFI+ KY AYM KYDSTHG FKG I     + L +N K I  + +RDPA IPWG +GVDYVVES+GVF           GGAK   IS+ S
Sbjct:    4 KVGINGFGRIGRIVFRNAVEHDDVEIVAVNDPFIETKYAAYMLKYDSTHGQFKGDIQHSSSNNLTVNNKTIHFYQERDPANIPWGKHGVDYVVESTGVFTTTEKAKAHLSGGAKKVIISAPS 125          
BLAST of FC876172 vs. ExPASy Swiss-Prot
Match: G3P_PHARH (Glyceraldehyde-3-phosphate dehydrogenase OS=Phaffia rhodozyma GN=GPD PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.134e-27
Identity = 65/122 (53.28%), Postives = 74/122 (60.66%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFXXXXXXXXXXXGGAKGGYISSIS 732
            KVGINGFGRIGR+                NDPFID +YM YMFKYDSTHGVFKG++  + D  L I GK I V+ +RDPA I WG  G DYVVES+GVF           GGAK   IS+ S
Sbjct:    4 KVGINGFGRIGRIVLRNAIIHGDIDVVAINDPFIDLEYMVYMFKYDSTHGVFKGSVE-IKDGKLVIEGKPIVVYGERDPANIQWGAAGADYVVESTGVFTTQEKAELHLKGGAKKVVISAPS 124          
BLAST of FC876172 vs. ExPASy Swiss-Prot
Match: G3P_AJECA (Glyceraldehyde-3-phosphate dehydrogenase OS=Ajellomyces capsulata GN=GPD PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.134e-27
Identity = 63/122 (51.64%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFXXXXXXXXXXXGGAKGGYISSIS 732
            KVGINGFGRIGR+                NDPFI+  Y AYM KYDSTHG FKGTI+V + + L +NGK +  + +RDPA IPWG +GV+YVVES+GVF           GGAK   IS+ S
Sbjct:    4 KVGINGFGRIGRIVFRNAIEHGEVNVVAVNDPFIETHYAAYMLKYDSTHGQFKGTIDV-NSNGLTVNGKAVTFYQERDPASIPWGKHGVEYVVESTGVFTTTEKASAHLKGGAKKVIISAPS 124          
BLAST of FC876172 vs. ExPASy Swiss-Prot
Match: G3P_COTJA (Glyceraldehyde-3-phosphate dehydrogenase OS=Coturnix coturnix japonica GN=GAPDH PE=2 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 5.399e-27
Identity = 63/122 (51.64%), Postives = 73/122 (59.84%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFXXXXXXXXXXXGGAKGGYISSIS 732
            KVG+NGFGRIGRL                NDPFID  YM YMFKYDSTHG FKGT+   ++  L ING  I +F +RDP+ I WGD G +YVVES+GVF           GGAK   IS+ S
Sbjct:    3 KVGVNGFGRIGRLVTRAAVLSGKVQVVAINDPFIDLNYMVYMFKYDSTHGHFKGTVKA-ENGKLVINGNAITIFQERDPSNIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPS 123          
BLAST of FC876172 vs. ExPASy Swiss-Prot
Match: G3P_YARLI (Glyceraldehyde-3-phosphate dehydrogenase OS=Yarrowia lipolytica GN=GPD PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.051e-27
Identity = 64/122 (52.46%), Postives = 74/122 (60.66%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFXXXXXXXXXXXGGAKGGYISSIS 732
            KVGINGFGRIGR+                NDPFID +Y AYMFKYDSTHG FKG +   D   + I+GK I+VF +RDP+ IPWG  G DYVVES+GVF           GGAK   IS+ S
Sbjct:    4 KVGINGFGRIGRIVLRNALKNPEVEVVAVNDPFIDTEYAAYMFKYDSTHGRFKGKVEAKDGGLI-IDGKHIQVFGERDPSNIPWGKAGADYVVESTGVFTGKEAASAHLKGGAKKVIISAPS 124          
BLAST of FC876172 vs. ExPASy Swiss-Prot
Match: G3P_SPECI (Glyceraldehyde-3-phosphate dehydrogenase OS=Spermophilus citellus GN=GAPDH PE=2 SV=3)

HSP 1 Score: 120.939 bits (302), Expect = 7.051e-27
Identity = 63/122 (51.64%), Postives = 73/122 (59.84%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFXXXXXXXXXXXGGAKGGYISSIS 732
            KVG+NGFGRIGRL                NDPFID  YM YMF+YDSTHG F GT+   ++  L INGK I +F +RDPA I WGD G +YVVES+GVF           GGAK   IS+ S
Sbjct:    3 KVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKA-ENGKLVINGKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPS 123          
BLAST of FC876172 vs. ExPASy Swiss-Prot
Match: G3P_PODAN (Glyceraldehyde-3-phosphate dehydrogenase OS=Podospora anserina GN=GPD PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.051e-27
Identity = 63/122 (51.64%), Postives = 75/122 (61.48%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFXXXXXXXXXXXGGAKGGYISSIS 732
            KVGINGFGRIGR+                NDPFI+ KY  YM KYDSTHGVFKGTI V   S L +NGK +K +++RDP+ IPW D G +Y+VES+GVF           GGAK   IS+ S
Sbjct:    4 KVGINGFGRIGRIVFRNAVEHPDVEIVAVNDPFIEPKYAEYMLKYDSTHGVFKGTIQV-SGSDLIVNGKTVKFYTERDPSAIPWKDTGAEYIVESTGVFTTTEKASAHLKGGAKRVIISAPS 124          
The following BLAST results are available for this feature:
BLAST of FC876172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 231
Match NameE-valueIdentityDescription
G3P2_AGABI6.378e-2853.28Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agar... [more]
G3P_CRYCU1.421e-2754.47Glyceraldehyde-3-phosphate dehydrogenase OS=Crypto... [more]
G3P_CRIGR1.421e-2752.46Glyceraldehyde-3-phosphate dehydrogenase OS=Cricet... [more]
G3P_PARBA2.424e-2751.64Glyceraldehyde-3-phosphate dehydrogenase OS=Paraco... [more]
G3P_PHARH4.134e-2753.28Glyceraldehyde-3-phosphate dehydrogenase OS=Phaffi... [more]
G3P_AJECA4.134e-2751.64Glyceraldehyde-3-phosphate dehydrogenase OS=Ajello... [more]
G3P_COTJA5.399e-2751.64Glyceraldehyde-3-phosphate dehydrogenase OS=Coturn... [more]
G3P_YARLI7.051e-2752.46Glyceraldehyde-3-phosphate dehydrogenase OS=Yarrow... [more]
G3P_SPECI7.051e-2751.64Glyceraldehyde-3-phosphate dehydrogenase OS=Spermo... [more]
G3P_PODAN7.051e-2751.64Glyceraldehyde-3-phosphate dehydrogenase OS=Podosp... [more]

Pages

back to top
Libraries
Library NameType
DevOvary1cdna_library
Properties
Property NameValue
Genbank descriptionC32001B08EF DevOvary1 Citrus clementina cDNA clone C32001B08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876172 ID=FC876172|Name=FC876172|organism=Citrus clementina|type=EST|length=740bp
ACTGCCTCCTGCCTCCTCTCGAAAGCCGCAACAACCCAAACCTCGTTAGG
GTTTTTGCGAGAAGAGAGCTCGAAACAGTGTGCTTAAGCTCAACAAATGG
CCTTCTCTTCTCTCCTCAGATCTACGGCCTCCGCTTCTCTCGTCCGCGCC
GACCTCACTTCCTCGCCGTCCGATCGCGTCAAGGGATCATCGACTGCTGC
TTTCAGTCGCAACCTTAACACTTCGAGCATTTTCGGTACTTCAGTTCCAA
GTGGTTCATCTTCTTCATCACTACAGACATGTGCTGCAAAGAGTATTCAA
CCCATCAGAGCCACAGCTACTGAAATTCCTCCAACAATTCAAAAATCACG
GAGTGATGGAAACACAAAGGTCGGAATCAATGGTTTTGGTCGGATTGGAA
GGTTGGTTTTGCGAGTAGCAGCCTTCAGGGATGATGTTGACGTTGTGGCG
GTCAATGATCCTTTTATTGATGCCAAATACATGGCTTACATGTTTAAGTA
TGATTCTACTCATGGAGTTTTCAAGGGAACCATCAATGTCGTGGATGACT
CCACCTTAGAAATTAATGGGAAGCTGATTAAAGTTTTCAGCAAAAGGGAC
CCGGCAGAGATCCCTTGGGGTGACTATGGGGTTGATTATGTTGTTGAATC
TTCTGGAGTCTTTACAACATTGCGAAGGCTTCAGCTCACATGAAGGGGTG
GTGCAAAAGGTGGGTATATCAGCTCCATCAGCTGATGCAC
back to top