FC876177

Overview
NameFC876177
Unique NameFC876177
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length705
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10303 contig Ccv1_Contig10303:1..705. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876177 vs. ExPASy Swiss-Prot
Match: APX1_ARATH (L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2)

HSP 1 Score: 284.648 bits (727), Expect = 3.394e-76
Identity = 132/167 (79.04%), Postives = 150/167 (89.82%), Query Frame = 2
Query:  203 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGR 703
            MTKNYPTVSEDYKKAVEKC+RKLRG IAEKNCAP+M+R+AWHSAGT+D +++TGGPFGTMR  AEQAH AN+G+ IA+RLL+P +EQFPTIS+AD +QLAGVV VEVTGGPDIPFHPGR+DK +PP EGRLPDA +G DHLR VF  QMGLSDKDIVALSG HTLGR
Sbjct:    1 MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGREDKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGR 167          
BLAST of FC876177 vs. ExPASy Swiss-Prot
Match: APX1_PEA (L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2)

HSP 1 Score: 279.641 bits (714), Expect = 1.092e-74
Identity = 130/166 (78.31%), Postives = 147/166 (88.55%), Query Frame = 2
Query:  203 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLG 700
            M K+YPTVS DY+KA+EK KRKLRGFIAEK CAPL+LR+AWHSAGT+D KTKTGGPFGT++  AE AH ANNGLDIAVRLLEP KEQFP +SYAD YQLAGVV VE+TGGP++PFHPGR+DK EPP EGRLPDA +G+DHLR VFG  MGLSD+DIVALSGGHT+G
Sbjct:    1 MGKSYPTVSPDYQKAIEKAKRKLRGFIAEKKCAPLILRLAWHSAGTFDSKTKTGGPFGTIKHQAELAHGANNGLDIAVRLLEPIKEQFPIVSYADFYQLAGVVAVEITGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIG 166          
BLAST of FC876177 vs. ExPASy Swiss-Prot
Match: APX2_ORYSJ (L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 2.689e-73
Identity = 129/166 (77.71%), Postives = 146/166 (87.95%), Query Frame = 2
Query:  206 TKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGR 703
            +K+YPTVS++Y  AV K KRKLRG IAEKNCAPLMLR+AWHSAGT+DV ++TGGPFGTM+   EQ+H+AN GLDIAVRLL+P K+Q P +SYAD YQLAGVV VEVTGGP++PFHPGR DK EPP EGRLPDA QG+DHLRQVF AQMGLSDKDIVALSGGHTLGR
Sbjct:    3 SKSYPTVSDEYLAAVGKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVSSRTGGPFGTMKNPGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSAQMGLSDKDIVALSGGHTLGR 168          
BLAST of FC876177 vs. ExPASy Swiss-Prot
Match: APX1_ORYSJ (L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 2.277e-72
Identity = 127/167 (76.05%), Postives = 147/167 (88.02%), Query Frame = 2
Query:  203 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGR 703
            M KNYP VS +Y++AVEK ++KLR  IAEK+CAPLMLR+AWHSAGT+DV +KTGGPFGTM+  AE +H+AN GLDIAVR+LEP KE+ PTISYAD YQLAGVV VEV+GGP +PFHPGR+DK  PP EGRLPDA +G+DHLRQVFGAQMGLSD+DIVALSGGHTLGR
Sbjct:    1 MAKNYPVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTMKTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGREDKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALSGGHTLGR 167          
BLAST of FC876177 vs. ExPASy Swiss-Prot
Match: APX1_ORYSI (L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 2.277e-72
Identity = 127/167 (76.05%), Postives = 147/167 (88.02%), Query Frame = 2
Query:  203 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGR 703
            M KNYP VS +Y++AVEK ++KLR  IAEK+CAPLMLR+AWHSAGT+DV +KTGGPFGTM+  AE +H+AN GLDIAVR+LEP KE+ PTISYAD YQLAGVV VEV+GGP +PFHPGR+DK  PP EGRLPDA +G+DHLRQVFGAQMGLSD+DIVALSGGHTLGR
Sbjct:    1 MAKNYPVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTMKTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGREDKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALSGGHTLGR 167          
BLAST of FC876177 vs. ExPASy Swiss-Prot
Match: APX2_ARATH (L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3)

HSP 1 Score: 267.314 bits (682), Expect = 5.608e-71
Identity = 127/165 (76.97%), Postives = 144/165 (87.27%), Query Frame = 2
Query:  209 KNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGR 703
            K+YP V E+YKKAV++CKRKLRG IAEK+CAP++LR+AWHSAGT+DVKTKTGGPFGT+R   E AH ANNGLDIAVRLL+P KE FP +SYAD YQLAGVV VE+TGGP+IPFHPGR DK EPP EGRLP A +G DHLR VFG +MGL+DKDIVALSGGHTLGR
Sbjct:    4 KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFG-RMGLNDKDIVALSGGHTLGR 167          
BLAST of FC876177 vs. ExPASy Swiss-Prot
Match: APX3_ORYSJ (Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.255e-54
Identity = 103/162 (63.58%), Postives = 126/162 (77.78%), Query Frame = 2
Query:  218 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGR 703
            P V  +Y   VE+ +R LR  IA K+CAP+MLR+AWH AGTYD  TKTGGP G++R   E +H+AN G+ IA+ LLEP K++ P I+YADLYQLAGVV VEVTGGP I + PGR D ++ P+EGRLPDAK+G  HLR+VF  +MGLSDKDIVALSGGHTLG+
Sbjct:    5 PVVDAEYMAEVERARRDLRALIASKSCAPIMLRLAWHDAGTYDKATKTGGPNGSIRFPQEYSHAANAGIKIAIDLLEPMKQKHPKITYADLYQLAGVVAVEVTGGPTIDYVPGRRDSSDSPEEGRLPDAKKGAAHLREVF-YRMGLSDKDIVALSGGHTLGK 165          
BLAST of FC876177 vs. ExPASy Swiss-Prot
Match: APX3_ORYSI (Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.255e-54
Identity = 103/162 (63.58%), Postives = 126/162 (77.78%), Query Frame = 2
Query:  218 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGR 703
            P V  +Y   VE+ +R LR  IA K+CAP+MLR+AWH AGTYD  TKTGGP G++R   E +H+AN G+ IA+ LLEP K++ P I+YADLYQLAGVV VEVTGGP I + PGR D ++ P+EGRLPDAK+G  HLR+VF  +MGLSDKDIVALSGGHTLG+
Sbjct:    5 PVVDAEYMAEVERARRDLRALIASKSCAPIMLRLAWHDAGTYDKATKTGGPNGSIRFPQEYSHAANAGIKIAIDLLEPMKQRHPKITYADLYQLAGVVAVEVTGGPTIDYVPGRRDSSDSPEEGRLPDAKKGAAHLREVF-YRMGLSDKDIVALSGGHTLGK 165          
BLAST of FC876177 vs. ExPASy Swiss-Prot
Match: APX3_ARATH (L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 6.229e-54
Identity = 106/162 (65.43%), Postives = 122/162 (75.31%), Query Frame = 2
Query:  218 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGR 703
            P V  +Y K + K +R+LR  IA KNCAP+MLR+AWH AGTYD ++KTGGP G++R   E  H AN+GL IA+ L E  K + P I+YADLYQLAGVV VEVTGGPDI F PGR D    P+EGRLPDAKQG  HLR VF  +MGLSDKDIVALSGGHTLGR
Sbjct:    4 PIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDSNVCPKEGRLPDAKQGFQHLRDVF-YRMGLSDKDIVALSGGHTLGR 164          
BLAST of FC876177 vs. ExPASy Swiss-Prot
Match: APX4_ORYSJ (Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 3.418e-52
Identity = 101/162 (62.35%), Postives = 121/162 (74.69%), Query Frame = 2
Query:  218 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGR 703
            P V  +Y + V++ +R LR  I+ K CAP+MLR+AWH AGTYDV TKTGG  G++R   E  H +N GL IA+ LLEP K + P I+YADLYQLAGVV VEVTGGP + F PGR D +  P+EGRLPDAK+G  HLR +F  +MGLSDKDIVALSGGHTLGR
Sbjct:    4 PVVDAEYLRQVDRARRHLRALISSKGCAPIMLRLAWHDAGTYDVNTKTGGANGSIRYEEEYTHGSNAGLKIAIDLLEPIKAKSPKITYADLYQLAGVVAVEVTGGPTVEFIPGRRDSSVCPREGRLPDAKKGALHLRDIF-YRMGLSDKDIVALSGGHTLGR 164          
The following BLAST results are available for this feature:
BLAST of FC876177 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 71
Match NameE-valueIdentityDescription
APX1_ARATH3.394e-7679.04L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis... [more]
APX1_PEA1.092e-7478.31L-ascorbate peroxidase, cytosolic OS=Pisum sativum... [more]
APX2_ORYSJ2.689e-7377.71L-ascorbate peroxidase 2, cytosolic OS=Oryza sativ... [more]
APX1_ORYSJ2.277e-7276.05L-ascorbate peroxidase 1, cytosolic OS=Oryza sativ... [more]
APX1_ORYSI2.277e-7276.05L-ascorbate peroxidase 1, cytosolic OS=Oryza sativ... [more]
APX2_ARATH5.608e-7176.97L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis... [more]
APX3_ORYSJ1.255e-5463.58Probable L-ascorbate peroxidase 3 OS=Oryza sativa ... [more]
APX3_ORYSI1.255e-5463.58Probable L-ascorbate peroxidase 3 OS=Oryza sativa ... [more]
APX3_ARATH6.229e-5465.43L-ascorbate peroxidase 3, peroxisomal OS=Arabidops... [more]
APX4_ORYSJ3.418e-5262.35Probable L-ascorbate peroxidase 4 OS=Oryza sativa ... [more]

Pages

back to top
Libraries
Library NameType
DevOvary1cdna_library
Properties
Property NameValue
Genbank descriptionC32001C03EF DevOvary1 Citrus clementina cDNA clone C32001C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876177 ID=FC876177|Name=FC876177|organism=Citrus clementina|type=EST|length=705bp
CCTCCGCCGCTTTCAGATGTCTAGGATCTATGCTTTTCTGTTTCTCATTG
TGCATTCATCGGAAAGTGACGTTTACAGATCTGTTCCGTACGCCACCGTT
TTGAAATGCCGATCGTCGTTTTAACGTAGAATGTGAAAGTGTTTTTGTTT
TTGTTCTTGTTATTTCCTAAAACTGTTTTTTATTTTGAAAGCAGTTGAAA
AGATGACGAAGAATTACCCCACTGTTAGCGAGGATTACAAGAAGGCCGTG
GAGAAATGCAAGAGGAAGCTCAGAGGCTTCATCGCTGAGAAGAACTGCGC
TCCACTCATGCTCCGTATCGCGTGGCACTCAGCTGGTACATATGATGTGA
AGACCAAGACCGGAGGTCCATTCGGAACCATGAGGCTCGCTGCTGAGCAG
GCACACTCAGCCAACAACGGCCTCGATATTGCCGTTAGGCTTTTGGAGCC
GTTCAAGGAGCAGTTCCCTACCATCTCCTACGCTGACCTTTATCAGCTTG
CTGGTGTTGTTGGCGTTGAGGTTACCGGTGGGCCCGATATCCCCTTCCAC
CCTGGAAGAGATGACAAGGCTGAGCCACCTCAAGAAGGCCGGCTTCCTGA
TGCTAAACAGGGTAATGATCACTTGAGGCAGGTCTTTGGTGCTCAGATGG
GCCTCAGCGACAAGGATATTGTTGCTCTCTCTGGTGGCCACACCCTGGGA
AGGTG
back to top