FC876179

Overview
NameFC876179
Unique NameFC876179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10304 contig Ccv1_Contig10304:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA1_ARATH (Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic OS=Arabidopsis thaliana GN=GSA1 PE=1 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 4.798e-91
Identity = 165/211 (78.20%), Postives = 182/211 (86.26%), Query Frame = 2
Query:   65 MAATITXXXXXXXXSCSSKLTKRFXXXXXXXXXXVKMSVSVEEQKKNFTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            M+AT+T        SCSSK++KR           +KMSVSV+E+KK+F+L+ SEEAFN AK LMPGGVNSPVRAFKSVGGQP++ DSVKGS MWDIDGNEYIDYVGSWGPAIIGHADD+VLAAL ETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFT +E+  +FEGCYHGHA+ FLVKAGSGVATLGL
Sbjct:    1 MSATLTGSGTALGFSCSSKISKRVSSSPASNRCCIKMSVSVDEKKKSFSLQKSEEAFNAAKNLMPGGVNSPVRAFKSVGGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTNKEKFIKFEGCYHGHANAFLVKAGSGVATLGL 211          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_BRANA (Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Brassica napus GN=GSA PE=2 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 3.110e-90
Identity = 166/211 (78.67%), Postives = 182/211 (86.26%), Query Frame = 2
Query:   65 MAATITXXXXXXXXSCSSKLTKRFXXXXXXXXXXVKMSVSVEEQKKNFTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            M+AT+T        SCSSK++KR           +KMSVSV+E+KK+FTL+ SEEAFN AK LMPGGVNSPVRAFKSVGGQP++ DSVKGS MWDIDGNEYIDYVGSWGPAIIGHADD+VLAAL ETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFT +E+  +FEGCYHGHA+ FLVKAGSGVATLGL
Sbjct:    1 MSATLTGSGTALGFSCSSKISKRVSSSPSTRCS-IKMSVSVDEKKKSFTLQKSEEAFNAAKNLMPGGVNSPVRAFKSVGGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTNKEKFIKFEGCYHGHANAFLVKAGSGVATLGL 210          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_ARATH (Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic OS=Arabidopsis thaliana GN=GSA2 PE=2 SV=2)

HSP 1 Score: 323.168 bits (827), Expect = 8.469e-88
Identity = 164/211 (77.73%), Postives = 178/211 (84.36%), Query Frame = 2
Query:   65 MAATITXXXXXXXXSCSSKLTKRFXXXXXXXXXXVKMSVSVEEQKKNFTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            MAAT+T        SCS+K +KR           +KMSVSVEE+ K FTL+ SEEAFN AK LMPGGVNSPVRAFKSVGGQP+V DS KGS + DIDGNEYIDYVGSWGPAIIGHADD+VLAAL ETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTG+++  +FEGCYHGHA+ FLVKAGSGVATLGL
Sbjct:    1 MAATLTGSGIALGFSCSAKFSKR--ASSSSNRRCIKMSVSVEEKTKKFTLQKSEEAFNAAKNLMPGGVNSPVRAFKSVGGQPVVMDSAKGSRIRDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGKQKFIKFEGCYHGHANSFLVKAGSGVATLGL 209          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_TOBAC (Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Nicotiana tabacum GN=GSA PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 3.558e-86
Identity = 156/177 (88.14%), Postives = 166/177 (93.79%), Query Frame = 2
Query:  167 VKMSVSVEEQKKNFTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            +KM+ SV+E+KK FTL+ SEEAF+ AKELMPGGVNSPVRAFKSVGGQPI+ DSVKGS M DIDGNEYIDYVGSWGPAIIGHADD+VLAAL ETMKKGTSFGAPCLLEN LAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGR +I +FEGCYHGHADPFLVKAGSGVATLGL
Sbjct:   39 IKMTASVDEKKKTFTLQKSEEAFSKAKELMPGGVNSPVRAFKSVGGQPIIIDSVKGSRMRDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKKGTSFGAPCLLENTLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRPKIIKFEGCYHGHADPFLVKAGSGVATLGL 215          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SOLLC (Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 8.764e-85
Identity = 154/177 (87.01%), Postives = 165/177 (93.22%), Query Frame = 2
Query:  167 VKMSVSVEEQKKNFTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            ++M+ SV+E+KK FTL+ SEEAF+ AKELMPGGVNSPVRAFKSVGGQPI+ DSVKGS M DIDGNEYIDYVGSWGPAIIGHADD+VLAAL ETMKKGTSFGAPCLLEN LAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFT R +I +FEGCYHGHADPFLVKAGSGVATLGL
Sbjct:   42 IRMTASVDEKKKTFTLEKSEEAFSKAKELMPGGVNSPVRAFKSVGGQPIIIDSVKGSRMRDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKKGTSFGAPCLLENTLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTCRPKIIKFEGCYHGHADPFLVKAGSGVATLGL 218          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SOYBN (Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Glycine max GN=GSA1 PE=2 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 5.681e-84
Identity = 154/178 (86.52%), Postives = 162/178 (91.01%), Query Frame = 2
Query:  167 VKMSVSVEEQKKN-FTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            V M+VS++ +  N  TL  SEEAF  AKELMPGGVNSPVRAFKSVGGQPIV DSVKGS MWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLEN LAE+VI AVPSIEMVRFVNSGTEACMG LRLARA+TGRE+I +FEGCYHGHADPFLVKAGSGVATLGL
Sbjct:   26 VAMAVSIDPKTDNKLTLTKSEEAFAAAKELMPGGVNSPVRAFKSVGGQPIVIDSVKGSRMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENTLAELVIDAVPSIEMVRFVNSGTEACMGALRLARAYTGREKIIKFEGCYHGHADPFLVKAGSGVATLGL 203          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_ORYSJ (Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Oryza sativa subsp. japonica GN=GSA PE=2 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 2.819e-83
Identity = 150/177 (84.75%), Postives = 163/177 (92.09%), Query Frame = 2
Query:  167 VKMSVSVEEQKKNFTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            V+ ++SVE+ +K +T++ SEE FN AKELMPGGVNSPVRAFKSVGGQPIVFDSVKGS MWD+DGNEYIDYVGSWGPAIIGHADD V AAL ET+KKGTSFGAPC+LENVLAEMVISAVPSIEMVRFVNSGTEACMG LRL RAFTGRE+I +FEGCYHGHAD FLVKAGSGVATLGL
Sbjct:   39 VRAAISVEKGEKAYTVEKSEEIFNAAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSRMWDVDGNEYIDYVGSWGPAIIGHADDTVNAALIETLKKGTSFGAPCVLENVLAEMVISAVPSIEMVRFVNSGTEACMGALRLVRAFTGREKILKFEGCYHGHADSFLVKAGSGVATLGL 215          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_HORVU (Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Hordeum vulgare GN=GSA PE=1 SV=3)

HSP 1 Score: 305.834 bits (782), Expect = 1.399e-82
Identity = 150/177 (84.75%), Postives = 163/177 (92.09%), Query Frame = 2
Query:  167 VKMSVSVEEQKKNFTLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            V+ +VS++E  K +T++ SEE FN AKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWD+DGNEYIDYVGSWGPAIIGHADD+V AAL ET+KKGTSFGAPC LENVLA+MVISAVPSIEMVRFVNSGTEACMG LRL RAFTGRE+I +FEGCYHGHAD FLVKAGSGVATLGL
Sbjct:   32 VRAAVSIDE--KAYTVQKSEEIFNAAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDVDGNEYIDYVGSWGPAIIGHADDKVNAALIETLKKGTSFGAPCALENVLAQMVISAVPSIEMVRFVNSGTEACMGALRLVRAFTGREKILKFEGCYHGHADSFLVKAGSGVATLGL 206          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SYNP2 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=hemL PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 5.892e-73
Identity = 131/159 (82.39%), Postives = 147/159 (92.45%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            SEE F+ A++LMPGGV+SPVRAFKSVGGQPIVFD VKGS +WD+DGNEYIDYVG+WGPAI GHA+D+V AAL ET++KGTSFGAPCL EN+LAEMVI+AVPSIEMVRFVNSGTEACM VLRL RAFTGRE+I +FEGCYHGHAD FLV+AGSGVATLGL
Sbjct:   11 SEEIFSAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKGSRVWDVDGNEYIDYVGTWGPAICGHANDEVNAALRETLEKGTSFGAPCLKENILAEMVINAVPSIEMVRFVNSGTEACMSVLRLMRAFTGREKIIKFEGCYHGHADMFLVQAGSGVATLGL 169          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_ACAM1 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Acaryochloris marina (strain MBIC 11017) GN=hemL PE=3 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 8.508e-72
Identity = 128/159 (80.50%), Postives = 143/159 (89.94%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            SEE F  A++LMPGGV+SPVRAFKSVGGQPIVFD VKG+H+WD+DGN+YIDYVG+WGPAI GHA  +VL AL E + KGTSFGAPCLLENVLAEMVI AVPS+E+VRFVNSGTEACM VLRL RAFTGRE++ +FEGCYHGHAD FLVKAGSGVATLGL
Sbjct:   11 SEEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKGAHVWDVDGNQYIDYVGTWGPAICGHAHPEVLTALKEALDKGTSFGAPCLLENVLAEMVIDAVPSVEVVRFVNSGTEACMSVLRLMRAFTGREKVIKFEGCYHGHADMFLVKAGSGVATLGL 169          
The following BLAST results are available for this feature:
BLAST of FC876179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSA1_ARATH4.798e-9178.20Glutamate-1-semialdehyde 2,1-aminomutase 1, chloro... [more]
GSA_BRANA3.110e-9078.67Glutamate-1-semialdehyde 2,1-aminomutase, chloropl... [more]
GSA2_ARATH8.469e-8877.73Glutamate-1-semialdehyde 2,1-aminomutase 2, chloro... [more]
GSA_TOBAC3.558e-8688.14Glutamate-1-semialdehyde 2,1-aminomutase, chloropl... [more]
GSA_SOLLC8.764e-8587.01Glutamate-1-semialdehyde 2,1-aminomutase, chloropl... [more]
GSA_SOYBN5.681e-8486.52Glutamate-1-semialdehyde 2,1-aminomutase, chloropl... [more]
GSA_ORYSJ2.819e-8384.75Glutamate-1-semialdehyde 2,1-aminomutase, chloropl... [more]
GSA_HORVU1.399e-8284.75Glutamate-1-semialdehyde 2,1-aminomutase, chloropl... [more]
GSA_SYNP25.892e-7382.39Glutamate-1-semialdehyde 2,1-aminomutase OS=Synech... [more]
GSA_ACAM18.508e-7280.50Glutamate-1-semialdehyde 2,1-aminomutase OS=Acaryo... [more]

Pages

back to top
Libraries
Library NameType
DevOvary1cdna_library
Properties
Property NameValue
Genbank descriptionC32001C05EF DevOvary1 Citrus clementina cDNA clone C32001C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876179 ID=FC876179|Name=FC876179|organism=Citrus clementina|type=EST|length=698bp
GACAGTTTCTTATCTTGATTGACCGAGGAAAAGAGAAAGAGACATCAGAG
AGAGTGACACAAAAATGGCAGCTACAATTACAGGGGTAGGAGTTGGGTTA
GGGCTTTCATGTTCATCAAAGCTCACCAAGAGATTTTCTTCTTCTACTGG
ATCCTCTCGCTGTAGTGTTAAAATGTCGGTCTCTGTTGAGGAGCAGAAGA
AAAATTTCACTTTAAAAAACTCTGAAGAAGCTTTCAATGTCGCCAAGGAA
TTGATGCCTGGAGGTGTAAATTCACCTGTACGTGCCTTCAAATCTGTTGG
TGGTCAACCTATTGTGTTTGATTCCGTCAAGGGCTCACACATGTGGGATA
TCGATGGCAACGAGTACATTGACTATGTAGGTTCTTGGGGGCCGGCAATT
ATTGGTCACGCAGATGATCAGGTACTAGCAGCCTTGGGTGAAACAATGAA
GAAAGGAACCAGCTTTGGTGCTCCTTGTCTTCTAGAGAATGTTCTTGCAG
AAATGGTAATCTCAGCTGTTCCAAGCATAGAAATGGTTCGTTTTGTTAAC
TCAGGCACAGAAGCATGCATGGGTGTGCTTCGCCTTGCCCGTGCCTTCAC
TGGGAGAGAGAGGATCATNCAATTTGAGGGTTGTTATCATGGCCATGCTG
ATCCATTTCTTGTCAAGGCTGGTAGTGGAGTTGCCACCCTAGGGCTTC
back to top