FC876180

Overview
NameFC876180
Unique NameFC876180
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15052 contig Ccv1_Contig15052:1..694. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876180 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 78.1814 bits (191), Expect = 4.745e-14
Identity = 69/222 (31.08%), Postives = 106/222 (47.75%), Query Frame = 2
Query:   35 MKTSLVTTLSFL----ILALTTKPQLGASES--EPILDVYGNQVDSSHRYYLVSALWGVKTGGGISADKGK-NGQ--CPTDVIQLSPKDKRGKNLVLLP-NDNSIIVRESTNIKLKFSRVSSLQQCNKDSLWKVDNDNASLGKQFITIGEGK------TCQNLFKLEKVSASIFDMKIALDIPCLYKIVHCSTPVNGSCDTLCKDVGV-SNVDGVQRLVVVD 649
            MK   + +LSF     +LA    P L A++S   P+LD+ G ++ +   YY+V  L     GGG++      NG   CP  V+Q   +    + L   P N    +VR ST++ + FS     +  +  ++W++D  + S G+ F+TIG  K      T  + FK+E+   S F           YK+V C T V GSC   C DVG+  +  G +RL + D
Sbjct:    1 MKELTMLSLSFFFVSALLAAAANPLLSAADSAPNPVLDIDGEKLRTGTNYYIVPVLRD--HGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSS-TVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGF-----------YKLVFCPT-VCGSCKVKCGDVGIYIDQKGRRRLALSD 207          
BLAST of FC876180 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.076e-13
Identity = 59/218 (27.06%), Postives = 106/218 (48.62%), Query Frame = 2
Query:   35 MKTSLVTTLSFLILALTTKPQ---LGASESEPILDVYGNQVDSSHRYYLVSALWGVKTGGGISADKGKNGQCPTDVIQLSPKDKRGKNLVLLPNDN-SIIVRESTNIKLKFSRVSSLQQCNKDSLWKVDNDNASLGKQFITIGEGK------TCQNLFKLEKVSASIFDMKIALDIPCLYKIVHCSTPVNGSCDTLCKDVGVSNVDGVQRLVVVDDND 658
            MKT+  T +  L+ A T+K     +  + + P+LD  G+++ +  +YY++S++ G   GGG++  +     CP  V+Q       G  ++    D+   +VR ST++ ++F  +   + C+  ++W++DN + S GK ++T    K      T  + FK+EK                 YK   C + V  SC TLC D+G  + D  Q  + + DN+
Sbjct:    1 MKTA--TAVVLLLFAFTSKSYFFGVANAANSPVLDTDGDELQTGVQYYVLSSISGA-GGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPIRD-RLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGV------------LGYKFRFCPS-VCDSCTTLCSDIGRHSDDDGQIRLALSDNE 201          
BLAST of FC876180 vs. ExPASy Swiss-Prot
Match: SPOR1_IPOBA (Sporamin A OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.760e-11
Identity = 48/144 (33.33%), Postives = 77/144 (53.47%), Query Frame = 2
Query:  104 ASESEPILDVYGNQVDSSHRYYLVSALWGVKTGGGISADKGKNGQCPTDVIQLSPKD-KRGKNLVLLP---NDNSIIVRESTNIKLKFSRVSSLQQCNKDSLWKVDNDNASLGKQFITIGE-GKTCQNLFKLEKVSASIFDMKI 520
            AS   P+LD+ G++V +   YY+VSA+WG   GG   A      +C TDVI +SP D   G  + + P   +  S +V  ST    +F+ +++ + C  +  W + +D+AS G+ F+  GE      N FK+E V A++   K+
Sbjct:   37 ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMMSKCATDVI-VSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSAS-GQYFLKAGEFVSDNSNQFKIELVDANLNSYKL 177          
The following BLAST results are available for this feature:
BLAST of FC876180 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
MIRA_RICDU4.745e-1431.08Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
ASP_THECC3.076e-1327.0621 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
SPOR1_IPOBA3.760e-1133.33Sporamin A OS=Ipomoea batatas PE=2 SV=1[more]
back to top
Libraries
Library NameType
DevOvary1cdna_library
Properties
Property NameValue
Genbank descriptionC32001C06EF DevOvary1 Citrus clementina cDNA clone C32001C06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876180 ID=FC876180|Name=FC876180|organism=Citrus clementina|type=EST|length=698bp
AACAGACAGCAGCTACCACCAAAAAAATAAACAAATGAAGACTTCCTTAG
TAACAACACTCTCCTTCCTTATACTTGCTTTGACCACAAAACCTCAGTTG
GGCGCCTCAGAATCTGAACCTATCTTAGATGTCTATGGCAACCAGGTGGA
CTCCAGCCACAGGTATTATCTTGTCTCAGCACTCTGGGGAGTTAAAACCG
GCGGTGGAATTAGCGCGGACAAAGGCAAAAATGGACAGTGTCCAACGGAT
GTTATCCAATTAAGTCCTAAGGACAAAAGGGGAAAGAATTTAGTTTTACT
TCCGAATGACAATTCCATAATTGTCCGGGAGTCCACTAATATTAAATTGA
AATTCTCAAGAGTTTCTTCTCTTCAGCAGTGTAACAAAGATTCGTTGTGG
AAAGTTGACAACGATAACGCTTCATTAGGAAAGCAGTTTATAACAATCGG
TGAAGGTAAAACGTGTCAAAATTTGTTTAAACTTGAGAAAGTTAGTGCAT
CAATATTTGATATGAAAATAGCACTAGACATTCCCTGTCTATACAAAATT
GTTCATTGTTCAACACCTGTTAATGGTTCTTGTGATACACTCTGCAAAGA
CGTTGGCGTTTCTAATGTGGATGGCGTCCAACGTCTAGTTGTGGTTGATG
ATAATGATCAGCCAAATCTGCCTTTGCCTGNTGTGTTATTTCCAGCTG
back to top