FC876456

Overview
NameFC876456
Unique NameFC876456
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length558
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10364 contig Ccv1_Contig10364:1..558. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876456 vs. ExPASy Swiss-Prot
Match: PDIA6_MEDSA (Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 4.586e-79
Identity = 144/186 (77.42%), Postives = 164/186 (88.17%), Query Frame = 2
Query:    2 GTR-VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGDEKKAVFSKIERGVEVLEGSTARHGKIYLKVAKNYMDKGSDYAKKEIDRLQRMLDKSISAAK 556
            GT+ VLVEFYAPWCGHCK+LAP YEKVAA F  EDDVV+ANLDADKY+DLAEKY VSGFPTLKFFPKGNK GE+YGGGRDL+DFV+FINEK GTSRD KGQLTS AGIV  LD LVKEFVAA+ +EKKAVF++IE  V+ LEGS +R+GKIYLKV+K Y++KGSDYAK EI RL+R+L+KSIS AK
Sbjct:  164 GTKDVLVEFYAPWCGHCKSLAPIYEKVAAVFKSEDDVVIANLDADKYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGRDLDDFVAFINEKSGTSRDAKGQLTSEAGIVEDLDELVKEFVAANDEEKKAVFARIEEEVKKLEGSASRYGKIYLKVSKKYLEKGSDYAKNEIQRLERLLEKSISPAK 349          

HSP 2 Score: 105.916 bits (263), Expect = 1.356e-22
Identity = 44/90 (48.89%), Postives = 64/90 (71.11%), Query Frame = 2
Query:   14 LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTS 283
            LVEFYAPWCGHCK LAP YEK+  +F     V++A +D D++K +  KYGVSG+PT+++FPKG+ + +++ G R  E    F+N + GT+
Sbjct:   50 LVEFYAPWCGHCKKLAPEYEKLPNSFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKFEGPRTAESLAEFVNTEGGTN 139          
BLAST of FC876456 vs. ExPASy Swiss-Prot
Match: PDIA6_ARATH (Probable protein disulfide-isomerase A6 OS=Arabidopsis thaliana GN=At2g47470 PE=1 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 6.414e-73
Identity = 135/182 (74.18%), Postives = 151/182 (82.97%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGDEKKAVFSKIERGVEVLEGSTARHGKIYLKVAKNYMDKGSDYAKKEIDRLQRMLDKSISAAK 556
            VLVEFYAPWCGHCK+LAPTYEKVA  F  E+ VV+ANLDAD +K L EKYGVSGFPTLKFFPK NK G +Y GGRDL+DFVSFINEK GTSRD KGQLTS AGIV SLDALVKE VAAS DEKKAV S+IE     L+GST R+GK+YLK+AK+Y++KGSDYA KE +RL R+L KSIS  K
Sbjct:  162 VLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTSRDSKGQLTSKAGIVESLDALVKELVAASEDEKKAVLSRIEEEASTLKGSTTRYGKLYLKLAKSYIEKGSDYASKETERLGRVLGKSISPVK 343          

HSP 2 Score: 108.612 bits (270), Expect = 2.092e-23
Identity = 45/90 (50.00%), Postives = 66/90 (73.33%), Query Frame = 2
Query:   14 LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTS 283
            LVEFYAPWCGHCK LAP YEK+ A+F     V++A +D D+ K +  KYGVSG+PT+++FPKG+ + ++Y G R+ E    ++N++ GT+
Sbjct:   44 LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTN 133          
BLAST of FC876456 vs. ExPASy Swiss-Prot
Match: PDI1_DICDI (Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2)

HSP 1 Score: 161.384 bits (407), Expect = 2.720e-39
Identity = 81/184 (44.02%), Postives = 114/184 (61.96%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKY--KDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGDEKKAVFSKIERGVEVLEGSTARHGKIYLKVAKNYMDKGSDYAKKEIDRLQRMLDKSISAAK 556
            VLVEFYAPWCGHCK L P YE +   +A E DVV+A +D D    K +  KYGV+GFPTLK+F K +KDGE+Y  GRDL+ F+++IN++ G +R   G+L   AG V  LD +  EF+AA+ + +K +  K +  V+ L       G  Y+KV K   +K  D+   EI R+ +++  S+S  K
Sbjct:  163 VLVEFYAPWCGHCKKLMPDYEILGNTYANEKDVVIAKIDCDAADNKAICSKYGVTGFPTLKWFGKQSKDGEKYEQGRDLDTFINYINKQAGVNRVKGGKLAVGAGRVEQLDTIATEFIAAAAEVRKELVKKAQTVVDSLPEELRTEGSYYVKVMKTIAEKSIDFVTTEIARITKLVSGSMSGKK 346          

HSP 2 Score: 86.6557 bits (213), Expect = 8.514e-17
Identity = 43/94 (45.74%), Postives = 62/94 (65.96%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFA-LEDDVVVANLDADK--YKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTS 283
            V V+FYAPWCGHCK LAP +E +A  FA + + VV+A +D D+   K L  KY VSG+PTLK F K +   ++Y G R +++ +++IN    T+
Sbjct:   42 VFVKFYAPWCGHCKKLAPDFEILADTFAPVSNKVVIAKVDCDQADNKALCSKYDVSGYPTLKIFDK-STTAKDYNGARSVDELLTYINNHAKTN 134          
BLAST of FC876456 vs. ExPASy Swiss-Prot
Match: ERP38_NEUCR (Protein disulfide-isomerase erp38 OS=Neurospora crassa GN=erp38 PE=2 SV=2)

HSP 1 Score: 149.828 bits (377), Expect = 8.189e-36
Identity = 82/179 (45.81%), Postives = 111/179 (62.01%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKY--KDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGDEKKAVFSKIERGVEVLEGST-ARHGKIYLKVAKNYMDKGSDYAKKEIDRLQRMLDK 538
            VLV F APWCGHCKNLAPT+EK+AA FA + ++ +A +DAD    K  A +YGVSGFPT+KFFPKG+   E+Y GGR   D V F+NEK GT R   G L + AG +A+LD +V ++    G     V  + +  V+ L+ S   ++   YL+V  + + K   YA KE  RL+ +L K
Sbjct:  161 VLVAFTAPWCGHCKNLAPTWEKLAATFASDPEITIAKVDADAPTGKKSAAEYGVSGFPTIKFFPKGSTTPEDYNGGRSEADLVKFLNEKAGTHRTPGGGLDTVAGTIAALDEIVAKY--TGGASLAEVAEEAKEAVKSLKNSAELKYADYYLRVL-DKLSKSEGYATKEFARLEGILKK 336          

HSP 2 Score: 110.153 bits (274), Expect = 7.191e-24
Identity = 60/130 (46.15%), Postives = 78/130 (60.00%), Query Frame = 2
Query:    2 GTRVLVEFYAPWCGHCKNLAPTYEKVAAAFAL-EDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGDEKKAV 388
            G   LVEF+APWCGHCKNLAP YE++A A    +D V +A +DAD  + L +++GV GFPTLKFF   ++   +Y GGRDL+   +FI EK G     KG   S   I+   DA +K   A  GD+   V
Sbjct:   38 GKPTLVEFFAPWCGHCKNLAPVYEELATALEYAKDKVQIAKVDADAERALGKRFGVQGFPTLKFFDGKSEQPVDYKGGRDLDSLSNFIAEKTGVKARKKGSAPSLVNILN--DATIKG--AIGGDKNVLV 163          
BLAST of FC876456 vs. ExPASy Swiss-Prot
Match: TIGA_ASPNG (Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.804e-33
Identity = 80/182 (43.96%), Postives = 114/182 (62.64%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKY--KDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGDEKKAVFSKIERGVEVLEGSTARHGKIYLKVAKNYMDKGSDYAKKEIDRLQRMLDKSISA 550
            VLV F APWCGHCKNLAPT+E +A  F LE +VV+A +DAD    K  A + GVSG+PT+KFFPKG+ +   Y G R  + F+ F+NEK GT R   G L + AG +ASLD L+    AA       + + +++    L+   A++   Y+KVA + + + ++YA KE+ RL+++L K  SA
Sbjct:  160 VLVAFTAPWCGHCKNLAPTWEALANDFVLEPNVVIAKVDADAENGKATAREQGVSGYPTIKFFPKGSTESVPYEGARSEQAFIDFLNEKTGTHRTVGGGLDTKAGTIASLDELIASTSAAD------LAAAVKKAATELKDKYAQY---YVKVA-DKLSQNAEYAAKELARLEKILAKGGSA 331          

HSP 2 Score: 117.087 bits (292), Expect = 5.883e-26
Identity = 61/125 (48.80%), Postives = 77/125 (61.60%), Query Frame = 2
Query:    2 GTRVLVEFYAPWCGHCKNLAPTYEKVAAAFA-LEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGD 373
            G   LVEF+APWCGHCKNLAP YE++  AFA   D V V  +DAD+++DL  K+GV GFPTLK+F   + + E+Y GGRDLE   SFI+EK G    G  +  S   ++   DA  K  V    D
Sbjct:   37 GKPALVEFFAPWCGHCKNLAPVYEELGQAFAHASDKVTVGKVDADEHRDLGRKFGVQGFPTLKWFDGKSDEPEDYKGGRDLESLSSFISEKTGVKPRGPKKEPSKVEMLN--DATFKGAVGGDND 159          
BLAST of FC876456 vs. ExPASy Swiss-Prot
Match: PDI2_SCHPO (Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe GN=SPAC17H9.14c PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 6.073e-31
Identity = 77/183 (42.08%), Postives = 108/183 (59.02%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEE-YGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGDEKKAVFSKIERGVEVLEGSTARHGKIYLKVAKNYMDKGSDYAKKEIDRLQRML-DKSISAA 553
            VLVEFYA WCG+CK LAPTYE +   F  E +V +  ++AD + D+   + V+ FPT+KFFPK +KD  E Y G R LE  + +IN+K GT R   G L STAG + + D    EF+  S   K+ V  K+++    LE S +R  K Y KV +  ++   ++  KE  RL ++L  KSI+ A
Sbjct:  161 VLVEFYADWCGYCKRLAPTYETLGKVFKNEPNVEIVKINADVFADIGRLHEVASFPTIKFFPKDDKDKPELYEGDRSLESLIEYINKKSGTQRSPDGTLLSTAGRIPTFDEFAAEFLDMSNAAKEVVLEKVKQ--LALEDS-SRWTKYYKKVFEKILN-DENWVHKEAKRLSKLLRQKSIALA 339          

HSP 2 Score: 103.605 bits (257), Expect = 6.731e-22
Identity = 51/125 (40.80%), Postives = 77/125 (61.60%), Query Frame = 2
Query:   14 LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGNKDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGDEKKAV 388
            L+EFYA WCGHCK+LAP YE++ A F   +DV++  +DAD + D+A+KY ++GFPTL +FP    +  +Y   RD++    F++EK G     K ++   + +V  LD+L   F     D+KK V
Sbjct:   43 LIEFYATWCGHCKSLAPVYEELGALFEDHNDVLIGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDSLTQFVSEKTGIK---KRKIVLPSNVV-ELDSL--NFDKVVMDDKKDV 161          
BLAST of FC876456 vs. ExPASy Swiss-Prot
Match: PDIA1_RAT (Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 1.958e-21
Identity = 58/184 (31.52%), Postives = 94/184 (51.09%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALE-DDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGN-KDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGDEKKAVFSKIERGVEVLEGSTARHGKIYLKVAKNYMDKGSDYAKKEIDRLQRMLDKSISAAK 556
            +LVEFYAPWCGHCK LAP Y K AA    E  ++ +A +DA +  DLA++YGV G+PT+KFF  G+    +EY  GR+ +D V+++ ++ G +        +   +V S +  V  F   +G +    F      V+ +      +  ++   +K  +DK      K+ D  +   +  I+  K
Sbjct:   46 LLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDAGSDSAKQFLLAAEAVDDIPFGITSNSDVF---SKYQLDKDGVVLFKKFDEGRNNFEGEITKEK 226          

HSP 2 Score: 76.2554 bits (186), Expect = 1.151e-13
Identity = 39/97 (40.21%), Postives = 56/97 (57.73%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFP-KGNKDGEEYGGGRDLEDFVSFINEKCGTSRDGKG 298
            V VEFYAPWCGHCK LAP ++K+   +   +++V+A +D+   +   E   V  FPTLKFFP   ++   +Y G R L+ F  F+       +DG G
Sbjct:  390 VFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANE--VEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLE---SGGQDGAG 481          
BLAST of FC876456 vs. ExPASy Swiss-Prot
Match: PDIA1_CRIGR (Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.658e-20
Identity = 59/185 (31.89%), Postives = 95/185 (51.35%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALE-DDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGN-KDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLD-ALVKEFVAASGDEKKAVFSKIERGVEVLEGSTARHGKIYLKVAKNYMDKGSDYAKKEIDRLQRMLDKSISAAK 556
            +LVEFYAPWCGHCK LAP Y K AA    E  ++ +A +DA +  DLA++YGV G+PT+KFF  G+    +EY  GR+ +D V+++ ++ G +        +   ++ S + A++  F     D  K      E   ++  G T+  G      +K  +DK      K+ D  +   +  ++  K
Sbjct:   46 LLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAETLIDSSEVAVIGFFKDVESDSAKQFLLAAEAVDDIPFGITSNSGVF----SKYQLDKDGVVLFKKFDEGRNNFEGEVTKEK 226          

HSP 2 Score: 75.485 bits (184), Expect = 1.963e-13
Identity = 38/97 (39.18%), Postives = 56/97 (57.73%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFP-KGNKDGEEYGGGRDLEDFVSFINEKCGTSRDGKG 298
            V VEFYAPWCGHCK LAP ++K+   +   +++++A +D+   +   E   V  FPTLKFFP   ++   +Y G R L+ F  F+       +DG G
Sbjct:  390 VFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIIIAKMDSTANE--VEAVKVHSFPTLKFFPATADRTVIDYNGERTLDGFKKFLE---SGGQDGAG 481          
BLAST of FC876456 vs. ExPASy Swiss-Prot
Match: PDIA2_HUMAN (Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 2.165e-20
Identity = 54/129 (41.86%), Postives = 72/129 (55.81%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVV-VANLDADKYKDLAEKYGVSGFPTLKFFPKGNK-DGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLDALVKEFVAASGDEKKAVF 391
            +LVEFYAPWCGHC+ LAP Y K AA  A E  VV +A +D    ++LAE++GV+ +PTLKFF  GN+   EEY G RD E    ++  + G S        +   ++   D +V  F     DE  A F
Sbjct:   62 LLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDLQDEDVATF 190          

HSP 2 Score: 79.7221 bits (195), Expect = 1.041e-14
Identity = 38/86 (44.19%), Postives = 54/86 (62.79%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKG-NKDGEEYGGGRDLEDFVSFIN 265
            V V+FYAPWC HCK +AP +E +A  +   +D+++A LDA   +   + + V GFPTLK+FP G  +   EY   RDLE F  F++
Sbjct:  409 VFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANE--LDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLD 492          
BLAST of FC876456 vs. ExPASy Swiss-Prot
Match: PDIA1_RABIT (Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.693e-20
Identity = 54/145 (37.24%), Postives = 80/145 (55.17%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALE-DDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGN-KDGEEYGGGRDLEDFVSFINEKCGTSRDGKGQLTSTAGIVASLD-ALVKEFVAASGDEKKAVFSKIERGVEVLEGSTA 436
            +LVEFYAPWCGHCK LAP Y K A     E  D+ +A +DA +  DLA++YGV G+PT+KFF  G+    +EY  GR+ +D V+++ ++ G +        +   +V S + A++  F     D  K      E   ++  G TA
Sbjct:   45 LLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSDIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLADSAAAESLVESSEVAVIGFFKDVESDAAKQFLLAAEATDDIPFGLTA 189          

HSP 2 Score: 79.337 bits (194), Expect = 1.359e-14
Identity = 41/97 (42.27%), Postives = 55/97 (56.70%), Query Frame = 2
Query:   11 VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKG-NKDGEEYGGGRDLEDFVSFINEKCGTSRDGKG 298
            V VEFYAPWCGHCK LAP ++K+   +    D+V+A +D+   +   E   V  FPTLKFFP G  +   +Y G R L+ F  F+       +DG G
Sbjct:  389 VFVEFYAPWCGHCKQLAPIWDKLGETYKEHQDIVIAKMDSTANE--VEAVKVHSFPTLKFFPAGPGRTVIDYNGERTLDGFKKFLE---SGGQDGAG 480          
The following BLAST results are available for this feature:
BLAST of FC876456 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 68
Match NameE-valueIdentityDescription
PDIA6_MEDSA4.586e-7977.42Probable protein disulfide-isomerase A6 OS=Medicag... [more]
PDIA6_ARATH6.414e-7374.18Probable protein disulfide-isomerase A6 OS=Arabido... [more]
PDI1_DICDI2.720e-3944.02Protein disulfide-isomerase 1 OS=Dictyostelium dis... [more]
ERP38_NEUCR8.189e-3645.81Protein disulfide-isomerase erp38 OS=Neurospora cr... [more]
TIGA_ASPNG3.804e-3343.96Protein disulfide-isomerase tigA OS=Aspergillus ni... [more]
PDI2_SCHPO6.073e-3142.08Protein disulfide-isomerase C17H9.14c OS=Schizosac... [more]
PDIA1_RAT1.958e-2131.52Protein disulfide-isomerase OS=Rattus norvegicus G... [more]
PDIA1_CRIGR1.658e-2031.89Protein disulfide-isomerase OS=Cricetulus griseus ... [more]
PDIA2_HUMAN2.165e-2041.86Protein disulfide-isomerase A2 OS=Homo sapiens GN=... [more]
PDIA1_RABIT3.693e-2037.24Protein disulfide-isomerase OS=Oryctolagus cunicul... [more]

Pages

back to top
Libraries
Library NameType
EHRcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAN2CA03RM1 EHR Citrus clementina cDNA clone KN0AAN2CA03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876456 ID=FC876456|Name=FC876456|organism=Citrus clementina|type=EST|length=558bp
CGGCACGAGGGTTTTGGTTGAATTTTATGCACCATGGTGTGGCCATTGCA
AAAACCTTGCGCCTACATATGAAAAGGTGGCAGCCGCATTTGCATTGGAA
GATGATGTAGTCGTTGCTAATTTGGATGCTGACAAATACAAGGATCTGGC
TGAGAAGTATGGAGTTAGTGGATTTCCTACATTGAAGTTCTTTCCAAAAG
GCAACAAAGATGGTGAGGAATATGGGGGTGGCAGAGATTTGGAAGACTTT
GTTTCTTTCATCAATGAAAAATGTGGCACCAGTCGTGATGGAAAAGGACA
ACTTACTTCAACGGCGGGTATAGTTGCGAGCTTAGATGCCTTGGTGAAGG
AATTTGTTGCTGCTAGCGGTGATGAGAAGAAGGCAGTCTTCTCAAAGATT
GAACGGGGAGTTGAGGTGCTTGAGGGTTCCACTGCCAGGCATGGGAAGAT
TTACTTGAAAGTTGCAAAGAACTATATGGACAAAGGGAGTGATTATGCGA
AAAAGGAAATTGATCGCCTCCAGCGTATGCTTGACAAGTCAATCAGCGCG
GCAAAAGC
back to top