FC876459

Overview
NameFC876459
Unique NameFC876459
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length742
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14362 contig Ccv1_Contig14362:14..755. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876459 vs. ExPASy Swiss-Prot
Match: METB_ARATH (Cystathionine gamma-synthase, chloroplastic OS=Arabidopsis thaliana GN=CGS1 PE=2 SV=3)

HSP 1 Score: 139.428 bits (350), Expect = 1.930e-32
Identity = 72/85 (84.71%), Postives = 76/85 (89.41%), Query Frame = 2
Query:  479 LADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDF*EKRRASFEYGRYGNPPTVVVEEKISALEG 733
            L D K+  SFLSSDGSL +HAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDF EKR  SFEYGRYGNP TVV+E+KISALEG
Sbjct:  164 LTDSKH--SFLSSDGSLTVHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRSVSFEYGRYGNPTTVVLEDKISALEG 246          

HSP 2 Score: 70.8626 bits (172), Expect = 8.432e-12
Identity = 39/64 (60.94%), Postives = 44/64 (68.75%), Query Frame = 2
Query:  137 DPDFSGS--ARFDKPRISAARVIGASTASFSGLSSLIFRFPPNFVRQLSTKARRNCSNIGVAQI 322
            DPD  GS      + R+ A+  I +S    +GLSS I RFPPNFVRQLS KARRNCSNIGVAQI
Sbjct:   25 DPDLVGSPVGGSSRRRVHASAGISSSFTGDAGLSSRILRFPPNFVRQLSIKARRNCSNIGVAQI 88          
The following BLAST results are available for this feature:
BLAST of FC876459 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
METB_ARATH1.930e-3284.71Cystathionine gamma-synthase, chloroplastic OS=Ara... [more]
back to top
Libraries
Library NameType
EHRcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAN2CA06RM1 EHR Citrus clementina cDNA clone KN0AAN2CA06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876459 ID=FC876459|Name=FC876459|organism=Citrus clementina|type=EST|length=742bp
GCACGAGGTTCTTATCATAGAATACAGAGAGAGCAAAGCCGCCGTTCAAT
ACGACGTCGTAATGGCCGTGTCCTCATGTTCGAGTCAAAAAATTTTGTCC
TTCTCTTCTTCATGTTCGTCTTTTGAGTGCCGTTCCGATCCCGACTTCTC
GGGCTCGGCTCGGTTTGATAAACCGAGGATCTCGGCGGCGCGAGTCATCG
GAGCGTCGACGGCGTCGTTTAGCGGCCTGTCGTCTCTGATTTTCAGGTTT
CCGCCGAACTTCGTGCGCCAGCTTAGCACGAAGGCCAGGAGGAACTGCAG
CAACATCGGCGTGGCGCAAATCGTGGCGGCTTCGTGGTCGAACGGTGTGG
GTTCCGGCTCTAACTCGGCGGCGGCTGCAGCAGCTTCCGCTGCCCCCGCC
CCGCCCGTCCCCGTCGAGATTACGAGCGGCGATGACATCGCGCTTGTTGA
CGGATTGAAAAATGTACATCTGGAGGCCCTCGCTGATTTGAAAAACGAGG
CTTCGTTTTTGAGCTCCGATGGGAGCCTTGCAATTCATGCCGGTGAAAGA
TTAGGTCGTGGTATAGTAACAGATGCAATTACTACCCCAGTGGTGAATAC
TTCTGCTTACTTCTTTAAGAAAACTGCTGAGCTTATTGATTTCTAGGAGA
AACGTCGTGCGAGTTTTGAATATGGGAGGTATGGAAACCCACCAACTGTG
GTCGTTGAGGAGAAGATAAGTGCACTTGAGGGGGGCTGAATC
back to top