FC876466

Overview
NameFC876466
Unique NameFC876466
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length666
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10366 contig Ccv1_Contig10366:1..666. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876466 vs. ExPASy Swiss-Prot
Match: ZIP2_ARATH (Zinc transporter 2 OS=Arabidopsis thaliana GN=ZIP2 PE=2 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 2.928e-79
Identity = 148/230 (64.35%), Postives = 173/230 (75.22%), Query Frame = 3
Query:   15 STFAGGVSPYFYRWNESFLLLGTQFAGGVFLGTSMMHFLSDSNETFKDLTSKSYPFAFMLASAGYLLTMFGDCIINFVIKQG-----------SKKETRVDVEEEKSEEV--GTDGNPVFFRTSSIGDTILLILALCFHSVFEGIAIGVSATKGEAWRNLWTISLHKIFAAIAMGIALLRMIPKRPFLLTAAYSFAFAISSPIGVGIGIAIDATTQGHIADWIYAISMGL 665
            STF  GVSPYFYRWNESFLLLGTQF+GG+FL T+++HFLSD+NETF+ L  K YP+AFMLA+AGY LTM  D  + FV               S+++  V V+EE   E+  G D +    RTS  GDT LLI ALCFHS+FEGIAIG+S TK +AWRNLWTISLHK+FAA+AMGIALL++IPKRPF LT  YSFAF ISSPIGVGIGI I+AT+QG   DW YAISMGL
Sbjct:   74 STFLAGVSPYFYRWNESFLLLGTQFSGGIFLATALIHFLSDANETFRGLKHKEYPYAFMLAAAGYCLTMLADVAVAFVAAGSNNNHVGASVGESREDDDVAVKEEGRREIKSGVDVSQALIRTSGFGDTALLIFALCFHSIFEGIAIGLSDTKSDAWRNLWTISLHKVFAAVAMGIALLKLIPKRPFFLTVVYSFAFGISSPIGVGIGIGINATSQGAGGDWTYAISMGL 303          
BLAST of FC876466 vs. ExPASy Swiss-Prot
Match: ZIP11_ARATH (Zinc transporter 11 OS=Arabidopsis thaliana GN=ZIP11 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 2.484e-70
Identity = 136/226 (60.18%), Postives = 169/226 (74.78%), Query Frame = 3
Query:   12 VSTFAGGVSPYFYRWNESFLLLGTQFAGGVFLGTSMMHFLSDSNETFKDLT--------SKSYPFAFMLASAGYLLTMFGDCIINFVIKQGSKKETRVDVEEEKSEEVGTDGNPVFFRTSSIGDTILLILALCFHSVFEGIAIGVSATKGEAWRNLWTISLHKIFAAIAMGIALLRMIPKRPFLLTAAYSFAFAISSPIGVGIGIAIDATTQGHIADWIYAISMGL 665
            V TF  GVSPYF +W++ FL+LGTQFAGGVFL T++MHFLSD++ETF+ L         S +YPFA+MLA AG++LTM  D +I  +  + ++ +  +  E++ ++   T         +SIGD+ILLI+ALCFHSVFEGIAIG+S TK +AWR LWTI+LHKIFAAIAMGIALLRMIP RP   +  YSFAFAISSPIGV IGI IDATTQG IADWI+A+SM L
Sbjct:   58 VLTFISGVSPYFLKWSQGFLVLGTQFAGGVFLATALMHFLSDADETFRGLLTAEGESEPSPAYPFAYMLACAGFMLTMLADSVIAHIYSK-TQNDLELQGEDKSNQRSATT-------ETSIGDSILLIVALCFHSVFEGIAIGISETKSDAWRALWTITLHKIFAAIAMGIALLRMIPDRPLFSSITYSFAFAISSPIGVAIGIVIDATTQGSIADWIFALSMSL 275          
BLAST of FC876466 vs. ExPASy Swiss-Prot
Match: S39A1_TAKRU (Zinc transporter ZIP1 OS=Takifugu rubripes GN=slc39a1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.820e-11
Identity = 57/201 (28.36%), Postives = 93/201 (46.27%), Query Frame = 3
Query:   57 NESFLLLGTQFAGGVFLGTSMMH----FLSDSN-ETFKDLTSKSYPFAFMLASAGYLLTMFGDCII-NFVIKQGSKKETRVDVEEEKSEEVGTDGNP-----------VFFRTSSIGDTILLILALCFHSVFEGIAIGVSATKGEAWRNLWTISLHKIFAAIAMGIALLRMIPKRPFLLTAAYSFAFAISSPIGVGIGIAI 608
            + + L L + FAGGVFL    +     +LSD N E        S+P    + +AG+   +  + I+ N    + + +E    + E KS      G+            V F+  S   + +L L+L  HS+FEG+AIG+  T  +       I +HK     ++ + L++     P L  AAY   FA+ SP+G+ IGI++
Sbjct:   41 HRTVLSLISCFAGGVFLSACFLDIIPDYLSDINTELHARQLETSFPLPEFIMAAGFFTVLILERIVLNCKEMRATHEERTTLIPERKSGHGHGHGDGPDPESSGHHVHVDFQAHSPFRSFMLFLSLSLHSIFEGLAIGLQTTDPKVVEICIAILVHKSIIVFSLAVKLVQ--SAIPPLWVAAYIGVFALMSPVGIAIGISV 239          
The following BLAST results are available for this feature:
BLAST of FC876466 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ZIP2_ARATH2.928e-7964.35Zinc transporter 2 OS=Arabidopsis thaliana GN=ZIP2... [more]
ZIP11_ARATH2.484e-7060.18Zinc transporter 11 OS=Arabidopsis thaliana GN=ZIP... [more]
S39A1_TAKRU5.820e-1128.36Zinc transporter ZIP1 OS=Takifugu rubripes GN=slc3... [more]
back to top
Libraries
Library NameType
EHRcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAN2CB03RM1 EHR Citrus clementina cDNA clone KN0AAN2CB03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876466 ID=FC876466|Name=FC876466|organism=Citrus clementina|type=EST|length=666bp
GCACGAGGCTAGTAAGCACTTTTGCTGGTGGCGTTTCGCCTTACTTTTAT
CGATGGAACGAGAGTTTTCTTCTCCTCGGAACCCAATTTGCTGGCGGGGT
TTTTCTTGGGACGTCGATGATGCATTTCTTGAGTGATTCCAATGAAACTT
TCAAAGATTTAACATCCAAAAGTTACCCTTTTGCATTCATGCTAGCATCC
GCGGGTTATCTTTTAACCATGTTCGGTGATTGCATAATCAATTTTGTTAT
AAAGCAGGGTAGCAAAAAAGAAACTAGAGTGGATGTTGAAGAAGAGAAAA
GTGAAGAAGTGGGAACCGATGGTAATCCAGTTTTCTTCAGGACAAGTTCC
ATTGGAGACACCATTCTTCTCATTCTCGCCCTCTGTTTCCACTCAGTTTT
CGAAGGCATTGCCATTGGAGTTTCAGCTACCAAGGGAGAGGCTTGGAGGA
ATCTATGGACGATATCGTTGCACAAAATATTTGCAGCAATTGCAATGGGA
ATTGCACTGCTGAGGATGATACCGAAGAGGCCATTTTTGCTAACTGCGGC
TTACTCATTTGCCTTCGCGATTTCTAGTCCAATTGGTGTGGGGATAGGCA
TTGCCATTGACGCCACAACTCAAGGGCATATTGCTGATTGGATTTATGCA
ATTTCAATGGGACTTG
back to top