FC876470

Overview
NameFC876470
Unique NameFC876470
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length540
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC876470_ssr16 microsatellite FC876470_ssr16:16..25. BLAST: Citrus ESTs to Prunus persica proteins V1
FC876470_ssr46 microsatellite FC876470_ssr46:46..57. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10368 contig Ccv1_Contig10368:1..540. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876470 vs. ExPASy Swiss-Prot
Match: LAML_ARATH (Lamin-like protein OS=Arabidopsis thaliana GN=At5g15350 PE=1 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 5.206e-45
Identity = 80/151 (52.98%), Postives = 101/151 (66.89%), Query Frame = 2
Query:   89 PEVDATRWIVGANQGWTNNVNYTIWAKDKHFYNGDWLFFVYDRNQMNVLEVNKTDYESCNSDHPLHNWTTGAGRDVVPLNVTRHYYFISGKGFCYGGMKLAVRVENXXXXXXXXXIKEKSGTPSTLYRGQLVLP-AVFAIGAVWDAFVRFW 538
            P V A ++ VG N+ W  N+NYTIWA+ KHFY GDWL+FV+DRNQ N+LEVNKTDYE C +DHP+ NWT GAGRD+V LN T+HYY + GKG CYGGMKL+V+VE          +K            Q ++P ++FA  A+WD   R W
Sbjct:   22 PGVTAKKYTVGENKFWNPNINYTIWAQGKHFYLGDWLYFVFDRNQHNILEVNKTDYEGCIADHPIRNWTRGAGRDIVTLNQTKHYYLLDGKGGCYGGMKLSVKVEKLPPPPKSAPVKNIGSVSMVTGLAQFMIPVSLFAFPAMWDVISRMW 172          
BLAST of FC876470 vs. ExPASy Swiss-Prot
Match: BCP_PEA (Blue copper protein OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.997e-12
Identity = 41/102 (40.20%), Postives = 56/102 (54.90%), Query Frame = 2
Query:  101 ATRWIVGANQGWTNNVNYTIWAKDKHFYNGDWLFFVYDRNQMNVLEVNKTDYESCNSDHPLHNWTTGAGRDVVPLNVTRHYYFISG-KGFCYGGMKLAVRVE 403
            AT + VG   GW    +Y+ WA DK F  GD L F Y      V EV ++DY+SC S + +   +TGA    +PL     +YFI G  G   GGMKL+++V+
Sbjct:   24 ATVYTVGDTSGWVIGGDYSTWASDKTFAVGDSLVFNYGAGAHTVDEVKESDYKSCTSGNSISTDSTGA--TTIPLKKAGKHYFICGVPGHSTGGMKLSIKVK 123          
BLAST of FC876470 vs. ExPASy Swiss-Prot
Match: MAVI_CUCPE (Mavicyanin OS=Cucurbita pepo PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.587e-12
Identity = 40/104 (38.46%), Postives = 59/104 (56.73%), Query Frame = 2
Query:  101 ATRWIVGANQGWTNNV--NYTIWAKDKHFYNGDWLFFVYDRNQMNVLEVNKTDYESCNSDHPLHNWTTGAGRDVVPLNVTRHYYFISG-KGFCYGGMKLAVRVE 403
            AT   VG + GWT  V  +Y  WA    F+ GD L F Y+    NVL+V++  ++SCNS  P  ++T+GA  D +PL     +YF+ G  G C  G K+ ++V+
Sbjct:    1 ATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPAASYTSGA--DSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVD 102          
The following BLAST results are available for this feature:
BLAST of FC876470 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
LAML_ARATH5.206e-4552.98Lamin-like protein OS=Arabidopsis thaliana GN=At5g... [more]
BCP_PEA1.997e-1240.20Blue copper protein OS=Pisum sativum PE=2 SV=1[more]
MAVI_CUCPE7.587e-1238.46Mavicyanin OS=Cucurbita pepo PE=1 SV=1[more]
back to top
Libraries
Library NameType
EHRcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAN2CB07RM1 EHR Citrus clementina cDNA clone KN0AAN2CB07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876470 ID=FC876470|Name=FC876470|organism=Citrus clementina|type=EST|length=540bp
GCACGAGGCGGGAGTGAGAGAGAGAATGAGGGCAGGAATGACGGTGGCGG
CGGCGGCCGTGCTGGTGGTTGCCATGACGATTCTGGTGCCGGAGGTGGAT
GCAACTAGATGGATTGTGGGAGCCAACCAAGGTTGGACCAATAACGTGAA
CTATACCATATGGGCAAAAGATAAGCACTTTTACAATGGGGACTGGCTCT
TCTTTGTGTATGACAGGAACCAGATGAATGTGCTAGAGGTGAACAAAACA
GACTACGAATCATGCAACTCTGATCATCCCCTTCACAACTGGACCACAGG
AGCAGGAAGAGATGTGGTTCCTCTGAATGTGACCCGGCATTACTACTTCA
TCAGCGGAAAGGGCTTCTGCTATGGTGGCATGAAGTTAGCTGTCCGTGTT
GAGAACCCGCCTCCTCCTCCCTCGGCTTCCCCTATTAAAGAAAAGAGCGG
CACACCAAGTACTCTCTACAGAGGCCAGCTTGTTTTGCCAGCAGTTTTTG
CCATTGGTGCTGTCTGGGATGCATTCGTCCGGTTCTGGTA
back to top