FC876471

Overview
NameFC876471
Unique NameFC876471
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length798
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14362 contig Ccv1_Contig14362:14..811. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876471 vs. ExPASy Swiss-Prot
Match: METB_ARATH (Cystathionine gamma-synthase, chloroplastic OS=Arabidopsis thaliana GN=CGS1 PE=2 SV=3)

HSP 1 Score: 181.03 bits (458), Expect = 6.497e-45
Identity = 93/106 (87.74%), Postives = 99/106 (93.40%), Query Frame = 2
Query:  479 LADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKISALEGAESTVIMASGMCASTVMLLAL 796
            L D K+  SFLSSDGSL +HAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKR  SFEYGRYGNPTTVV+E+KISALEGAEST++MASGMCASTVMLLAL
Sbjct:  164 LTDSKH--SFLSSDGSLTVHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRSVSFEYGRYGNPTTVVLEDKISALEGAESTLVMASGMCASTVMLLAL 267          

HSP 2 Score: 70.8626 bits (172), Expect = 9.469e-12
Identity = 39/64 (60.94%), Postives = 44/64 (68.75%), Query Frame = 2
Query:  137 DPDFSGS--ARFDKPRISAARVIGASTASFSGLSSLIFRFPPNFVRQLSTKARRNCSNIGVAQI 322
            DPD  GS      + R+ A+  I +S    +GLSS I RFPPNFVRQLS KARRNCSNIGVAQI
Sbjct:   25 DPDLVGSPVGGSSRRRVHASAGISSSFTGDAGLSSRILRFPPNFVRQLSIKARRNCSNIGVAQI 88          
The following BLAST results are available for this feature:
BLAST of FC876471 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
METB_ARATH6.497e-4587.74Cystathionine gamma-synthase, chloroplastic OS=Ara... [more]
back to top
Libraries
Library NameType
EHRcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAN2CB08RM1 EHR Citrus clementina cDNA clone KN0AAN2CB08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876471 ID=FC876471|Name=FC876471|organism=Citrus clementina|type=EST|length=798bp
GCACGAGGTTCTTATCATAGAATACAGAGAGAGCAAAGCCGCCGTTCAAT
ACGACGTCGTAATGGCCGTGTCCTCATGTTCGAGTCAAAAAATTTTGTCC
TTCTCTTCTTCATGTTCGTCTTTTGAGTGCCGTTCCGATCCCGACTTCTC
GGGCTCGGCTCGGTTTGATAAACCGAGGATCTCGGCGGCGCGAGTCATCG
GAGCGTCGACGGCGTCGTTTAGCGGCCTGTCGTCTCTGATTTTCAGGTTT
CCGCCGAACTTCGTGCGCCAGCTTAGCACGAAGGCCAGGAGGAACTGCAG
CAACATCGGCGTGGCGCAAATCGTGGCGGCTTCGTGGTCGAACGGTGTGG
GTTCCGGCTCTAACTCGGCGGCGGCTGCAGCAGCTTCCGCTGCCCCCGCC
CCGCCCGTCCCCGTCGAGATTACGAGCGGCGATGACATCGCGCTTGTTGA
CGGATTGAAAAATGTACATCTGGAGGCCCTCGCTGATTTGAAAAACGAGG
CTTCGTTTTTGAGCTCCGATGGGAGCCTTGCAATTCATGCCGGTGAAAGA
TTAGGTCGTGGTATAGTAACAGATGCAATTACTACCCCAGTGGTGAATAC
TTCTGCTTACTTCTTTAAGAAAACTGCTGAGCTTATTGATTTCAAGGAGA
AACGTCGTGCAAGTTTTGAATATGGGAGGTATGGAAACCCAACAACTGTG
GTCGTTGAGGAGAAGATAAGTGCACTTGAGGGGGCTGAATCAACTGTGAT
TATGGCATCTGGAATGTGTGCTAGCACAGTCATGTTGTTGGCATTGGT
back to top