FC876473

Overview
NameFC876473
Unique NameFC876473
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length691
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10447 contig Ccv1_Contig10447:4..694. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876473 vs. ExPASy Swiss-Prot
Match: IM30_PEA (Membrane-associated 30 kDa protein, chloroplastic OS=Pisum sativum GN=IM30 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.440e-63
Identity = 137/201 (68.16%), Postives = 155/201 (77.11%), Query Frame = 1
Query:   94 MAAKSQIVTGF-TMPMTPAPXXXXXXXXXXLCMVKKPLTTSFFNGG-VGALKVTRLRIAPSSRSYCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKYKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKIVVNNLVSNTRL 690
            M  K QI +G  + P+ P+             ++KKPL T+ F    V  LK   +RIA   R      GGGA+  RMNLFDR ARVVKSYANA++S+FEDPEKILEQAVLEMNDDL KMRQATAQVLASQKRLENKYKAA+QASE+WYRKAQLALQKGEEDLAREALKRRKS+ADNA++LKAQLDQQK VV+NLVSNTRL
Sbjct:    1 MTTKFQIFSGLPSAPLQPSSS-----------LLKKPLATTLFGTRPVDTLKFRVMRIAKPVR------GGGAIGVRMNLFDRFARVVKSYANALVSTFEDPEKILEQAVLEMNDDLTKMRQATAQVLASQKRLENKYKAAQQASEEWYRKAQLALQKGEEDLAREALKRRKSFADNASSLKAQLDQQKSVVDNLVSNTRL 184          
BLAST of FC876473 vs. ExPASy Swiss-Prot
Match: IM30_ARATH (Probable membrane-associated 30 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=At1g65260 PE=1 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.525e-60
Identity = 128/200 (64.00%), Postives = 150/200 (75.00%), Query Frame = 1
Query:   94 MAAKSQIVTGFTMPMTPAPXXXXXXXXXXLCMVK-KPLTTSFFNGGVGALKVTRLRIAPSSRSYCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKYKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKIVVNNLVSNTRL 690
            MA K+  VTG   P+ P             C ++  PL TSFF    GAL+V  LR+A  +R  C   G GA    MNLF+R +RVVKSYANA++SSFEDPEKILEQ V+EMN DL KMRQATAQVLASQK+L+NKYKAA+Q+S+DWY++AQLAL KG+EDLAREALKRRKS+ADNA ALK QLDQQK VV+NLVSNTRL
Sbjct:    1 MALKASPVTGLFPPLRPTASSSPSTSSNRPCSLRILPLRTSFFGNSSGALRVNVLRLACDNRLRC--NGHGAT---MNLFERFSRVVKSYANALISSFEDPEKILEQTVIEMNSDLTKMRQATAQVLASQKQLQNKYKAAQQSSDDWYKRAQLALAKGDEDLAREALKRRKSFADNATALKTQLDQQKGVVDNLVSNTRL 195          
BLAST of FC876473 vs. ExPASy Swiss-Prot
Match: IM30_ORYSJ (Probable membrane-associated 30 kDa protein, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0895100 PE=1 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 8.979e-58
Identity = 121/163 (74.23%), Postives = 137/163 (84.05%), Query Frame = 1
Query:  202 LTTSFFNGGVGALKVTRLRIAPSSRSYCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKYKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKIVVNNLVSNTRL 690
            L TSF NG V +L++ ++R +  +R  C          R NL DR +RVVKSYANA+LSSFEDPEKIL+QAVLEMNDDL KMRQATAQVLASQKRLENKYKAAEQAS+DWYR+AQLALQKG+EDLAREALKRRKSYADNA++LKAQLDQQK VV NLVSNTR+
Sbjct:   27 LRTSFLNGSV-SLRLIQVRQSNVNRFKCN-------GIRSNLLDRFSRVVKSYANAVLSSFEDPEKILDQAVLEMNDDLTKMRQATAQVLASQKRLENKYKAAEQASDDWYRRAQLALQKGDEDLAREALKRRKSYADNASSLKAQLDQQKGVVENLVSNTRV 181          
BLAST of FC876473 vs. ExPASy Swiss-Prot
Match: Y617_SYNY3 (Uncharacterized protein sll0617 OS=Synechocystis sp. (strain PCC 6803) GN=sll0617 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.398e-26
Identity = 61/121 (50.41%), Postives = 84/121 (69.42%), Query Frame = 1
Query:  319 MNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKYKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKIVVNNLVSN 681
            M LFDRL RVV++  N ++S  EDPEK+LEQAV++M +DLV++RQA A+ +A +KR E +     Q ++ W  +A+LAL  GEE+LAREAL R+KS  D A A + QL QQ+ +  NL  N
Sbjct:    1 MGLFDRLGRVVRANLNDLVSKAEDPEKVLEQAVIDMQEDLVQLRQAVARTIAEEKRTEQRLNQDTQEAKKWEDRAKLALTNGEENLAREALARKKSLTDTAAAYQTQLAQQRTMSENLRRN 121          
BLAST of FC876473 vs. ExPASy Swiss-Prot
Match: PSPA_SHIFL (Phage shock protein A OS=Shigella flexneri GN=pspA PE=3 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.603e-14
Identity = 40/108 (37.04%), Postives = 64/108 (59.26%), Query Frame = 1
Query:  319 MNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKYKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQL 642
            M +F R A +V +  NA+L   EDP+K++   + EM D LV++R  +A+ LA +K+L  + + A     +W  KA+LAL K  EDLAR AL  ++   D   +L+ ++
Sbjct:    1 MGIFSRFADIVNANINALLEKAEDPQKLVRLMIQEMEDTLVEVRSTSARALAEKKQLTRRIEQASAREVEWQEKAELALLKEREDLARAALIEKQKLTDLIKSLEHEV 108          
BLAST of FC876473 vs. ExPASy Swiss-Prot
Match: PSPA_ECOLI (Phage shock protein A OS=Escherichia coli (strain K12) GN=pspA PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.603e-14
Identity = 40/108 (37.04%), Postives = 64/108 (59.26%), Query Frame = 1
Query:  319 MNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKYKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQL 642
            M +F R A +V +  NA+L   EDP+K++   + EM D LV++R  +A+ LA +K+L  + + A     +W  KA+LAL K  EDLAR AL  ++   D   +L+ ++
Sbjct:    1 MGIFSRFADIVNANINALLEKAEDPQKLVRLMIQEMEDTLVEVRSTSARALAEKKQLTRRIEQASAREVEWQEKAELALLKEREDLARAALIEKQKLTDLIKSLEHEV 108          
BLAST of FC876473 vs. ExPASy Swiss-Prot
Match: PSPA_ECO57 (Phage shock protein A OS=Escherichia coli O157:H7 GN=pspA PE=3 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.603e-14
Identity = 40/108 (37.04%), Postives = 64/108 (59.26%), Query Frame = 1
Query:  319 MNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKYKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQL 642
            M +F R A +V +  NA+L   EDP+K++   + EM D LV++R  +A+ LA +K+L  + + A     +W  KA+LAL K  EDLAR AL  ++   D   +L+ ++
Sbjct:    1 MGIFSRFADIVNANINALLEKAEDPQKLVRLMIQEMEDTLVEVRSTSARALAEKKQLTRRIEQASAREVEWQEKAELALLKEREDLARAALIEKQKLTDLIKSLEHEV 108          
BLAST of FC876473 vs. ExPASy Swiss-Prot
Match: PSPA_DEIRA (Phage shock protein A homolog OS=Deinococcus radiodurans GN=DR_1473 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.603e-14
Identity = 42/123 (34.15%), Postives = 72/123 (58.54%), Query Frame = 1
Query:  319 MNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKYKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKIVVNNLVSNTR 687
            M++FDRL+R++++  N ++S  EDP KI++QA+ +M       R   A  +A   +LE +     + + ++ +KA+ AL+ G EDLAREAL+R +++ D A     Q   Q+  V+ L +  R
Sbjct:    1 MSIFDRLSRLLRANVNDMISKAEDPAKIIDQALRDMRSAYADARNEVAGAMAQAAKLEREAGTNSKLAAEYEKKAEEALRGGSEDLAREALRRAQNHKDLAKGFDEQRTVQQSTVDQLKTQLR 123          
The following BLAST results are available for this feature:
BLAST of FC876473 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
IM30_PEA2.440e-6368.16Membrane-associated 30 kDa protein, chloroplastic ... [more]
IM30_ARATH2.525e-6064.00Probable membrane-associated 30 kDa protein, chlor... [more]
IM30_ORYSJ8.979e-5874.23Probable membrane-associated 30 kDa protein, chlor... [more]
Y617_SYNY31.398e-2650.41Uncharacterized protein sll0617 OS=Synechocystis s... [more]
PSPA_SHIFL1.603e-1437.04Phage shock protein A OS=Shigella flexneri GN=pspA... [more]
PSPA_ECOLI1.603e-1437.04Phage shock protein A OS=Escherichia coli (strain ... [more]
PSPA_ECO571.603e-1437.04Phage shock protein A OS=Escherichia coli O157:H7 ... [more]
PSPA_DEIRA1.603e-1434.15Phage shock protein A homolog OS=Deinococcus radio... [more]
back to top
Libraries
Library NameType
EHRcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAN2CB10RM1 EHR Citrus clementina cDNA clone KN0AAN2CB10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876473 ID=FC876473|Name=FC876473|organism=Citrus clementina|type=EST|length=691bp
GCACGAGGAATTTCTCGTCTTCTATCCAAAAGCACTCTGAAAACCAATCG
TTCTGTTTCCTGACAATAATTGAACTTGTGGGCATCCCGCAGAATGGCCG
CAAAGTCACAGATAGTTACGGGATTCACCATGCCCATGACACCAGCGCCG
TCCTCTTCTTCCTCGAGCTCTAGCAGCAGTCTCTGCATGGTCAAGAAGCC
CCTCACGACGTCGTTTTTCAACGGCGGAGTGGGAGCTCTAAAAGTTACAA
GGTTAAGGATTGCTCCTTCCAGCCGATCCTATTGTTATAGACAAGGTGGA
GGAGCACTTAATACACGAATGAACCTATTTGATAGGTTAGCAAGAGTTGT
GAAGTCCTATGCAAATGCAATTCTGAGTTCCTTTGAAGATCCAGAGAAGA
TTTTAGAGCAAGCAGTACTTGAAATGAATGATGACTTGGTAAAGATGCGC
CAGGCCACGGCACAAGTGTTGGCATCTCAGAAGCGGTTGGAAAATAAGTA
CAAAGCTGCAGAGCAAGCTTCTGAAGACTGGTATCGCAAAGCACAGCTTG
CTCTTCAAAAAGGGGAAGAAGATCTGGCACGTGAGGCTCTCAAGAGACGC
AAATCTTATGCAGATAATGCTAATGCTTTGAAAGCTCAACTTGATCAACA
AAAGATTGTTGTTAATAACCTTGTTTCTAATACTCGGCTTT
back to top