FC876476

Overview
NameFC876476
Unique NameFC876476
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10369 contig Ccv1_Contig10369:1..739. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876476 vs. ExPASy Swiss-Prot
Match: NT5D_DICDI (5'-nucleotidase domain-containing protein DDB_G0275467 OS=Dictyostelium discoideum GN=DDB_G0275467 PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.027e-33
Identity = 71/176 (40.34%), Postives = 100/176 (56.82%), Query Frame = 1
Query:  142 EKDTLAFTKVDAFIPNKIYYHGCLTSFLPITKWNGPEVIYFGDLLFSDLIGPS-KAGWRTAAIIHELESEIRIQNDDTYRFEQAKFHIIHELLGKLQATVANMQRTEACHLLLAELNEERQKARRMMKKMFNKSFGATFLTDTGQESAFAYHIHRYADVYTNKAENFVLYPPQAWL 666
            + D   + +V+ F P K+Y  G L  F  ++KW G  V+YFGD L+SDL+ PS K GW+T  II ELE E+ IQN   YR + A+   + +++ K Q         E   L L +L  ER K R  +K+ FN +FG+ F T T   + FA  + R+AD+YT+K EN + YP  A L
Sbjct:  408 DSDRYDWNEVNHFEPKKVYVGGSLKQFTNVSKWRGRSVMYFGDHLYSDLVEPSQKEGWKTGVIIKELEVEVGIQNSPKYREQLAELLQLEDVIRKCQ-----FFSGEKKELFLEQLKTERYKKRLALKEPFNANFGSLFRTHT-NATIFASSLQRHADIYTSKIENLISYPLTASL 577          

HSP 2 Score: 39.2762 bits (90), Expect = 2.027e-33
Identity = 16/43 (37.21%), Postives = 25/43 (58.14%), Query Frame = 3
Query:   27 MRFMLEDSTGYTYS-WRELFDVVIAQANKPDFYTSDHPFRKGH 152
            M+++L D     Y  W ++FDV+I + +KP F+    PFR  H
Sbjct:  364 MKYLLNDQLNGKYEDWTDVFDVIITKCDKPSFFGKGRPFRMYH 406          
BLAST of FC876476 vs. ExPASy Swiss-Prot
Match: NT5D3_MOUSE (5'-nucleotidase domain-containing protein 3 OS=Mus musculus GN=Nt5dc3 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.095e-27
Identity = 61/162 (37.65%), Postives = 87/162 (53.70%), Query Frame = 1
Query:  136 LSEKDTLAFTKVDAFIPNKIYYHGCLTSFLPITKWNGPEVIYFGDLLFSDLIGPS-KAGWRTAAIIHELESEIRIQNDDTYRFEQAKFHIIHELLGKLQATVANMQRTEACHLLLAELNEERQKARRMMKKMFNKSFGATFLTDTGQESAFAYHIHRYADVY 618
            ++EK  L + K+      +IY  G L  FL +T W G +V+YFGD ++SDL   + K GWRT AII EL SE+RI N + Y         +  LL ++Q     + R     L+L E  +ER++ R M K  FN  FG+ F TD    + F   + R+AD+Y
Sbjct:  343 VNEKGVLLWDKIHKLQKGQIYKQGNLYEFLKLTGWRGSKVLYFGDHIYSDLADLTLKHGWRTGAIIPELRSELRIMNTEQYIQTMTWLQTLTGLLEQMQ-----VHRDAESQLVLQEWKKERKEMREMTKSFFNAQFGSLFRTDQ-NPTYFLRRLSRFADIY 498          

HSP 2 Score: 40.0466 bits (92), Expect = 4.095e-27
Identity = 22/46 (47.83%), Postives = 28/46 (60.87%), Query Frame = 3
Query:   12 FVDG*MRFMLEDSTGYTYSWRELFDVVIAQANKPDFYTSD-HPFRK 146
            FVD  MR+++         WR+LFDVVI QA KP+F+     PFRK
Sbjct:  303 FVDKGMRYIVGKD------WRDLFDVVIVQAEKPNFFNDKRRPFRK 342          
BLAST of FC876476 vs. ExPASy Swiss-Prot
Match: NT5D3_HUMAN (5'-nucleotidase domain-containing protein 3 OS=Homo sapiens GN=NT5DC3 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 3.374e-26
Identity = 60/162 (37.04%), Postives = 86/162 (53.09%), Query Frame = 1
Query:  136 LSEKDTLAFTKVDAFIPNKIYYHGCLTSFLPITKWNGPEVIYFGDLLFSDLIGPS-KAGWRTAAIIHELESEIRIQNDDTYRFEQAKFHIIHELLGKLQATVANMQRTEACHLLLAELNEERQKARRMMKKMFNKSFGATFLTDTGQESAFAYHIHRYADVY 618
            ++EK  L + K+      +IY  G L  FL +T W G  V+YFGD ++SDL   + K GWRT AII EL SE++I N + Y         +  LL ++Q     + R     L+L E  +ER++ R M K  FN  FG+ F TD    + F   + R+AD+Y
Sbjct:  345 MNEKGVLLWDKIHKLQKGQIYKQGNLYEFLKLTGWRGSRVLYFGDHIYSDLADLTLKHGWRTGAIIPELRSELKIMNTEQYIQTMTWLQTLTGLLEQMQ-----VHRDAESQLVLQEWKKERKEMREMTKSFFNAQFGSLFRTDQ-NPTYFLRRLSRFADIY 500          

HSP 2 Score: 38.1206 bits (87), Expect = 3.374e-26
Identity = 17/27 (62.96%), Postives = 20/27 (74.07%), Query Frame = 3
Query:   69 WRELFDVVIAQANKPDFYTSD-HPFRK 146
            WR+LFDVVI QA KP+F+     PFRK
Sbjct:  318 WRDLFDVVIVQAEKPNFFNDKRRPFRK 344          
BLAST of FC876476 vs. ExPASy Swiss-Prot
Match: NT5D2_RAT (5'-nucleotidase domain-containing protein 2 OS=Rattus norvegicus GN=Nt5dc2 PE=2 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 7.440e-26
Identity = 66/180 (36.67%), Postives = 94/180 (52.22%), Query Frame = 1
Query:  136 LSEKDTLAFTKVDAFIPNKIYYHGCLTSFLPITKWNGPEVIYFGDLLFSDLIG-PSKAGWRTAAIIHELESEIRIQNDDTYRFEQAKFHIIHELLGKLQATVANMQRTEACHLLLAELNEERQKARRMMKKMFNKSFGATFLTDTGQESAFAYHIHRYADVY-------TNKAENFVLYP 651
            L EK +L + ++      KIY  G L  FL +T+W GP V+YFGD L+SDL     + GWRT AII ELE EIRI N + Y         +  LL ++Q      Q  E+   +LA   +ERQ+ R + K +FN  FG+ F T     + F+  + R++D+Y        N + +F  YP
Sbjct:  347 LDEKGSLHWDRITRLEKGKIYRQGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLERMQ----TYQDAES-RQVLATWMKERQELRCITKALFNAQFGSIFRT-FHNPTYFSRRLVRFSDLYMASLSCLLNYSVDFTFYP 520          

HSP 2 Score: 41.9726 bits (97), Expect = 7.440e-26
Identity = 24/46 (52.17%), Postives = 29/46 (63.04%), Query Frame = 3
Query:   12 FVDG*MRFMLEDSTGYTYSWRELFDVVIAQANKPDFYTSDH-PFRK 146
            FVD  MR M+         WR+LFDVVI QA+KP+F+T    PFRK
Sbjct:  307 FVDKGMRHMVGPD------WRQLFDVVIVQADKPNFFTDRRKPFRK 346          
BLAST of FC876476 vs. ExPASy Swiss-Prot
Match: NT5D2_HUMAN (5'-nucleotidase domain-containing protein 2 OS=Homo sapiens GN=NT5DC2 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 7.447e-26
Identity = 66/180 (36.67%), Postives = 94/180 (52.22%), Query Frame = 1
Query:  136 LSEKDTLAFTKVDAFIPNKIYYHGCLTSFLPITKWNGPEVIYFGDLLFSDLIG-PSKAGWRTAAIIHELESEIRIQNDDTYRFEQAKFHIIHELLGKLQATVANMQRTEACHLLLAELNEERQKARRMMKKMFNKSFGATFLTDTGQESAFAYHIHRYADVY-------TNKAENFVLYP 651
            L EK +L + ++      KIY  G L  FL +T+W GP V+YFGD L+SDL     + GWRT AII ELE EIRI N + Y         +  LL ++Q      Q  E+  +L A + +ERQ+ R + K +FN  FG+ F T     + F+  + R++D+Y        N   +F  YP
Sbjct:  314 LDEKGSLQWDRITRLEKGKIYRQGNLFDFLRLTEWRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLERMQ----TYQDAESRQVLAAWM-KERQELRCITKALFNAQFGSIFRT-FHNPTYFSRRLVRFSDLYMASLSCLLNYRVDFTFYP 487          

HSP 2 Score: 41.5874 bits (96), Expect = 7.447e-26
Identity = 24/46 (52.17%), Postives = 28/46 (60.87%), Query Frame = 3
Query:   12 FVDG*MRFMLEDSTGYTYSWRELFDVVIAQANKPDFYTSDH-PFRK 146
            FVD  MR M+         WR+LFDVVI QA+KP F+T    PFRK
Sbjct:  274 FVDKGMRHMVGPD------WRQLFDVVIVQADKPSFFTDRRKPFRK 313          
BLAST of FC876476 vs. ExPASy Swiss-Prot
Match: NT5D3_XENLA (5'-nucleotidase domain-containing protein 3 OS=Xenopus laevis GN=nt5dc3 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 2.783e-25
Identity = 60/172 (34.88%), Postives = 91/172 (52.91%), Query Frame = 1
Query:  136 LSEKDTLAFTKVDAFIPNKIYYHGCLTSFLPITKWNGPEVIYFGDLLFSDLIGPS-KAGWRTAAIIHELESEIRIQNDDTYRFEQAKFHIIHELLGKLQATVANMQRTEACHLLLAELNEERQKARRMMKKMFNKSFGATFLTDTGQESAFAYHIHRYADVYTNKAENFVLY 648
            ++E+  L + K+      + Y  G L  FL +T W G +V+YFGD ++SDL   + K GWRT AII EL+SEI I N   Y    A    +  LL ++Q     + R     ++L +  +ERQ+ R + K MFN+ FG+ F TD    + F   + R+AD+Y     + + Y
Sbjct:  293 VAERGILLWDKIHHLEKGQTYKQGNLFEFLKLTGWRGSKVLYFGDHIYSDLADLTLKHGWRTGAIIPELKSEIEIMNTSHYIKTMAWLQGLTGLLERMQ-----VYRDAESQMVLQDWIKERQETRDLTKTMFNRQFGSIFRTD-HNPTYFLRRLSRFADIYMESLSSLLNY 458          

HSP 2 Score: 38.5058 bits (88), Expect = 2.783e-25
Identity = 17/27 (62.96%), Postives = 21/27 (77.78%), Query Frame = 3
Query:   69 WRELFDVVIAQANKPDFYTSD-HPFRK 146
            WR+LFDVVI QA+KP+F+     PFRK
Sbjct:  266 WRDLFDVVIVQADKPNFFNDKRRPFRK 292          
BLAST of FC876476 vs. ExPASy Swiss-Prot
Match: NT5D3_XENTR (5'-nucleotidase domain-containing protein 3 OS=Xenopus tropicalis GN=nt5dc3 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.758e-24
Identity = 58/162 (35.80%), Postives = 88/162 (54.32%), Query Frame = 1
Query:  136 LSEKDTLAFTKVDAFIPNKIYYHGCLTSFLPITKWNGPEVIYFGDLLFSDLIGPS-KAGWRTAAIIHELESEIRIQNDDTYRFEQAKFHIIHELLGKLQATVANMQRTEACHLLLAELNEERQKARRMMKKMFNKSFGATFLTDTGQESAFAYHIHRYADVY 618
            ++E+  L + K+      + Y  G L  FL +T W G +V+YFGD ++SDL   + K GWRT AII EL+SEI I N   Y         +  LL ++Q     + R     ++L +  +ERQ+ R + +KMFN+ FG+ F TD    + F   + R+AD+Y
Sbjct:  328 VAERGILLWDKIHHLEKGQTYKQGNLFEFLKLTGWRGSKVLYFGDHIYSDLADLTLKHGWRTGAIIPELKSEIEIMNTSHYITTVTWLQGLTGLLERMQ-----VYRDAESQMVLQDWIKERQEMRDLARKMFNRQFGSIFRTD-HNPTYFLRRLSRFADIY 483          

HSP 2 Score: 38.5058 bits (88), Expect = 1.758e-24
Identity = 17/27 (62.96%), Postives = 21/27 (77.78%), Query Frame = 3
Query:   69 WRELFDVVIAQANKPDFYTSD-HPFRK 146
            WR+LFDVVI QA+KP+F+     PFRK
Sbjct:  301 WRDLFDVVIVQADKPNFFNDKRRPFRK 327          
BLAST of FC876476 vs. ExPASy Swiss-Prot
Match: 5NTC_DICDI (Cytosolic purine 5'-nucleotidase OS=Dictyostelium discoideum GN=nt5c2 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.564e-17
Identity = 58/187 (31.02%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  118 FTHLTILSEKDT----LAFTKV-DAFIPNKIYYHGCLTSFLPITKWNGPEVIYFGDLLFSDLIGPSKA-GWRTAAIIHELESEIRIQN---DDTYRFEQAKFHIIHELLGKLQATVANMQRTEACHLLLAELNEERQKARRMMKKMFNKSFGATFLTDTGQESAFAYHIHRYADVYTNKAENFVLYP 651
            F+  T + E DT    L  T V D F   K+Y+ G L+ F  +T   G  V+Y GD +F+D+I   K  GWR   ++ EL+ E+ + N   D T      +F I  E+   L +        E  H  L   N++   A       +NK FG+ F  +  + + F+  + RYAD+YT+   N + YP
Sbjct:  389 FSEGTTIREVDTETGNLRITNVKDRFEQGKVYHGGSLSLFQKLTGAKGSRVLYIGDHIFADIIKSKKTHGWRNLLVVPELQHELEVMNQQKDTTIHLMNLEF-IRAEIYRGLDSESTTPPDIEVLHQHLKNTNDKLNFA-------YNKYFGSLF-KNGSKSTFFSMQVQRYADLYTSDYLNLLNYP 566          

HSP 2 Score: 32.7278 bits (73), Expect = 3.564e-17
Identity = 14/40 (35.00%), Postives = 22/40 (55.00%), Query Frame = 3
Query:   27 MRFMLEDSTGYTYSWRELFDVVIAQANKPDFYTSDHPFRK 146
            M +M+        SWR+ FDV+I  A+KP F++     R+
Sbjct:  358 MSYMMNGYNPNYQSWRDYFDVIIVGADKPRFFSEGTTIRE 397          
The following BLAST results are available for this feature:
BLAST of FC876476 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
NT5D_DICDI2.027e-3340.345'-nucleotidase domain-containing protein DDB_G027... [more]
NT5D3_MOUSE4.095e-2737.655'-nucleotidase domain-containing protein 3 OS=Mus... [more]
NT5D3_HUMAN3.374e-2637.045'-nucleotidase domain-containing protein 3 OS=Hom... [more]
NT5D2_RAT7.440e-2636.675'-nucleotidase domain-containing protein 2 OS=Rat... [more]
NT5D2_HUMAN7.447e-2636.675'-nucleotidase domain-containing protein 2 OS=Hom... [more]
NT5D3_XENLA2.783e-2534.885'-nucleotidase domain-containing protein 3 OS=Xen... [more]
NT5D3_XENTR1.758e-2435.805'-nucleotidase domain-containing protein 3 OS=Xen... [more]
5NTC_DICDI3.564e-1731.02Cytosolic purine 5'-nucleotidase OS=Dictyostelium ... [more]
back to top
Libraries
Library NameType
EHRcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAN2CC01RM1 EHR Citrus clementina cDNA clone KN0AAN2CC01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876476 ID=FC876476|Name=FC876476|organism=Citrus clementina|type=EST|length=725bp
CGCACGAGGATTTTGTTGATGGATGAATGCGTTTTATGTTGGAGGATTCC
ACAGGTTACACATACTCATGGAGGGAGCTTTTTGATGTGGTGATTGCGCA
AGCTAATAAGCCAGACTTTTACACATCTGACCATCCTTTCCGAAAAGGAC
ACTTTAGCTTTTACAAAAGTGGATGCGTTTATTCCAAATAAAATCTATTA
CCATGGATGCCTTACATCATTCCTTCCAATTACTAAGTGGAATGGCCCAG
AGGTGATATACTTTGGTGATCTCCTATTTAGTGACCTAATAGGGCCTTCG
AAGGCTGGTTGGCGCACTGCTGCCATCATCCATGAACTGGAAAGTGAAAT
ACGTATACAAAATGATGACACTTATCGTTTTGAGCAGGCAAAATTTCATA
TAATACACGAATTGCTTGGTAAATTGCAGGCGACTGTAGCTAATATGCAA
AGGACTGAAGCATGCCATTTGCTTTTGGCTGAGCTTAATGAAGAAAGGCA
GAAAGCACGCCGGATGATGAAAAAAATGTTCAATAAATCATTTGGAGCCA
CATTCCTGACCGATACTGGTCAAGAATCTGCTTTTGCATATCATATTCAT
CGATATGCAGATGTTTATACCAATAAGGCAGAGAACTTTGTGCTGTACCC
GCCACAAGCATGGCTTCATGTTCCATTTGATATCGTAATCATGCCACGTC
ATGTGAAGGTCCCCTCGAGCTTGTT
back to top