FC877780

Overview
NameFC877780
Unique NameFC877780
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length828
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC877780_ssr65 microsatellite FC877780_ssr65:65..76. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig4349 contig Ccv1_Contig4349:26..853. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877780 vs. ExPASy Swiss-Prot
Match: ILL6_ARATH (IAA-amino acid hydrolase ILR1-like 6 OS=Arabidopsis thaliana GN=ILL6 PE=2 SV=2)

HSP 1 Score: 330.872 bits (847), Expect = 5.415e-90
Identity = 154/195 (78.97%), Postives = 177/195 (90.77%), Query Frame = 2
Query:  239 CGVWSRACSKEVMELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFF 823
            C VW++ACS E++ L  +P+ V WL+ VRRTIH+NPELAF+E+ETSRL+R+ELDRM I Y+YPLAKTGIRAW+G+GGPPFVA+RADMDALPIQEAVEWE+ SKVAGKMHACGHDAHV ML+GAA ILK+REHLLKGTV+L+FQPAEEAGNGAK M+ DGAL+DVEAIFAVHVSH HPTGVIGSR GPLLAGCG F
Sbjct:   65 CRVWTKACSDEILRLTYQPDNVAWLKRVRRTIHENPELAFEEYETSRLIRSELDRMGIMYRYPLAKTGIRAWIGSGGPPFVAVRADMDALPIQEAVEWEHISKVAGKMHACGHDAHVTMLLGAAHILKAREHLLKGTVVLLFQPAEEAGNGAKNMIEDGALDDVEAIFAVHVSHIHPTGVIGSRSGPLLAGCGIF 259          
BLAST of FC877780 vs. ExPASy Swiss-Prot
Match: ILL6_ORYSJ (IAA-amino acid hydrolase ILR1-like 6 OS=Oryza sativa subsp. japonica GN=ILL6 PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 6.866e-77
Identity = 138/186 (74.19%), Postives = 162/186 (87.10%), Query Frame = 2
Query:  266 KEVMELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFF 823
            +E+  +A RPET  WLR+VRR IH+ PELA++E ETSRL+R ELD M +G+++P+A+TG+ A +GTG PP VALRADMDALPIQEAVEWE+KSK  GKMHACGHDAHVAML+GAAKILK+REH L+GTV L+FQPAEE+G GAKRM+  GALEDVEAIFAVHVSH+HPT VIGSR GPLLAGCGFF
Sbjct:   97 EEIAGMAGRPETAAWLRAVRRRIHERPELAYEEVETSRLVRDELDAMGVGFRHPVARTGVVANIGTGRPPVVALRADMDALPIQEAVEWEHKSKNPGKMHACGHDAHVAMLLGAAKILKAREHHLRGTVRLLFQPAEESGAGAKRMIEGGALEDVEAIFAVHVSHQHPTSVIGSRTGPLLAGCGFF 282          
BLAST of FC877780 vs. ExPASy Swiss-Prot
Match: ILL2_ORYSJ (IAA-amino acid hydrolase ILR1-like 2 OS=Oryza sativa subsp. japonica GN=ILL2 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 4.766e-70
Identity = 125/185 (67.57%), Postives = 152/185 (82.16%), Query Frame = 2
Query:  269 EVMELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFF 823
            +V++ ARRPE   W+  VR  IH+ PELAF+E ETSRL+RAELD M + Y++P+A TG+ A VGTG PPFVALRADMDALP+QE V+WE+KSKVA KMHACGHDAH  ML+GAA+IL+ R H L+GTV+L+FQP EE G GA+RM+  GA+++VEAIF  HVS E PTGV+GSRPGPLLAGCGFF
Sbjct:   49 DVLDRARRPEFAAWMAGVRWAIHERPELAFEEIETSRLVRAELDAMGVAYRHPVAGTGVVATVGTGRPPFVALRADMDALPMQEEVQWEHKSKVAMKMHACGHDAHTTMLLGAARILQERRHELQGTVVLLFQPGEEVGTGARRMVEAGAVDNVEAIFGFHVSVELPTGVVGSRPGPLLAGCGFF 233          
BLAST of FC877780 vs. ExPASy Swiss-Prot
Match: ILL1_ORYSJ (IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. japonica GN=ILL1 PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 6.029e-65
Identity = 115/184 (62.50%), Postives = 146/184 (79.35%), Query Frame = 2
Query:  272 VMELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFF 823
            ++  A+  E   W+  +RR IH+NPEL ++EF TS L+R ELD + I Y++P A TG+ A VGTGGPPFVALRADMDALP+QE+VEWE+KSKV GKMH CGHDAHVAML+G+A+IL+     LKGTV+L+FQPAEE G GAK+M+ DGA+E++EAIF VHV+   P GV+ SRPGP++AG GFF
Sbjct:   36 LLRRAKEAEFAGWMVGLRRRIHENPELGYEEFATSELVRRELDALGIPYRHPFAVTGVVATVGTGGPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSARILQEHRDELKGTVVLVFQPAEEGGGGAKKMIDDGAVENIEAIFGVHVADVVPIGVVASRPGPVMAGSGFF 219          
BLAST of FC877780 vs. ExPASy Swiss-Prot
Match: ILL1_ORYSI (IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. indica GN=ILL1 PE=2 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.754e-64
Identity = 114/184 (61.96%), Postives = 145/184 (78.80%), Query Frame = 2
Query:  272 VMELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFF 823
            ++  A+  E   W+  +RR IH+NPEL ++EF TS L+R ELD + I Y++P A TG+ A VGTGGPPFVALRADMDALP+QE+VEWE+KSKV GKMH CGHDAHVAML+G+A+IL+     LKGTV+L+FQPAEE G GAK+M+ DG +E++EAIF VHV+   P GV+ SRPGP++AG GFF
Sbjct:   36 LLRRAKEAEFAGWMVGLRRRIHENPELGYEEFATSELVRRELDALGIPYRHPFAVTGVVATVGTGGPPFVALRADMDALPMQESVEWEHKSKVPGKMHGCGHDAHVAMLLGSARILQEHRDELKGTVVLVFQPAEEGGGGAKKMIDDGTVENIEAIFGVHVADVVPIGVVASRPGPVMAGSGFF 219          
BLAST of FC877780 vs. ExPASy Swiss-Prot
Match: ILL2_ARATH (IAA-amino acid hydrolase ILR1-like 2 OS=Arabidopsis thaliana GN=ILL2 PE=1 SV=2)

HSP 1 Score: 242.276 bits (617), Expect = 2.533e-63
Identity = 113/185 (61.08%), Postives = 144/185 (77.84%), Query Frame = 2
Query:  269 EVMELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFF 823
            +++E A+ PE  DW+  +RR IH+NPEL ++E ETS+L+R+EL+ + I Y+YP+A TG+  ++GTG PPFVALRADMDALPIQE VEWE+KSK+AGKMHACGHD HV ML+GAAKIL    H L+GTV+LIFQPAEE  +GAK+M  +GAL++VEAIF +H+S   P G   SR G  LAG G F
Sbjct:   37 KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVF 221          
BLAST of FC877780 vs. ExPASy Swiss-Prot
Match: ILL4_ARATH (IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsis thaliana GN=ILL4 PE=1 SV=2)

HSP 1 Score: 239.58 bits (610), Expect = 1.642e-62
Identity = 111/183 (60.66%), Postives = 144/183 (78.69%), Query Frame = 2
Query:  275 MELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFF 823
            + LA+R +  DW+  +RR IH+NPEL ++E ETS+L+RAEL++M + YKYP+A TG+  +VGTG  PFVALRADMDAL +QE VEWE+KSKV GKMHACGHDAH  ML+GAAK+LK  E  L+GTV+L+FQPAEE G GAK+++  G LE+V AIF +HV+++   G + SR GP+LAG GFF
Sbjct:   36 LTLAKRNDFFDWMVGIRRRIHENPELGYEEVETSKLVRAELEKMGVSYKYPVAVTGVVGYVGTGHAPFVALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEHEEELQGTVVLVFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLALGQVSSREGPMLAGSGFF 218          
BLAST of FC877780 vs. ExPASy Swiss-Prot
Match: ILR1_ARATH (IAA-amino acid hydrolase ILR1 OS=Arabidopsis thaliana GN=ILR1 PE=1 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 1.177e-60
Identity = 113/204 (55.39%), Postives = 145/204 (71.08%), Query Frame = 2
Query:  227 PFSSCGVWSRACSKE-----VMELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFF 823
            P SS G +      E     ++  A+ PE  +W+R +RR IH+NPE  FQEF+TS+L+R ELD + + YKYP+AKTG+ AW+G+   P   LRADMDALP+QE VEWE KSKV GKMHACGHD HVAML+GAAK+L++ +HL+KGTV L+FQP EE   GA  M+ D  L+D++ I +VHV    P+G IGSRPG +LAG G F
Sbjct:   19 PLSSAGSYDSGSGLESLARGMLHSAKDPEFFEWMRGIRRKIHENPETGFQEFKTSQLVRDELDSLGVKYKYPVAKTGVVAWIGSCSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAAKLLQTTKHLIKGTVKLVFQPGEEGYAGAYEMLKDEILDDLDGILSVHVFPSIPSGGIGSRPGTVLAGAGLF 222          
BLAST of FC877780 vs. ExPASy Swiss-Prot
Match: ILL5_ARATH (IAA-amino acid hydrolase ILR1-like 5 OS=Arabidopsis thaliana GN=ILL5 PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.301e-59
Identity = 110/186 (59.14%), Postives = 141/186 (75.81%), Query Frame = 2
Query:  266 KEVMELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFF 823
            K  + LA+R +  DW+  +RR IH+NPEL ++E ETS+L++ ELD+M + YK P+A TG+  +VGTG  PFVALRADMDALPIQE VEWE+KSK+ GKMHACGHDAH  ML+GAAK+LK  +  L+GTVIL+FQPAEE G GAK+++  G LE+V AIF +HVS+    G + SR G L+AG G F
Sbjct:   33 KNFLSLAKREDFFDWMVGIRRRIHENPELGYEEVETSKLVKTELDKMGVSYKNPVAVTGVIGYVGTGHAPFVALRADMDALPIQEMVEWEHKSKIPGKMHACGHDAHTTMLLGAAKLLKEHQEELQGTVILVFQPAEEGGAGAKKIVEAGVLENVGAIFGLHVSNLLGLGQLSSREGLLMAGSGRF 218          
BLAST of FC877780 vs. ExPASy Swiss-Prot
Match: ILL1_ARATH (IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsis thaliana GN=ILL1 PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.301e-59
Identity = 111/183 (60.66%), Postives = 140/183 (76.50%), Query Frame = 2
Query:  275 MELARRPETVDWLRSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFF 823
            +ELA+ PE  D +  +RR IH+NPEL ++EFETS+ +R+ELD + + Y++P+A TGI  ++GTG PPFVALRADMDALPIQEAVEWE+KSK  GKMHACGHD HVAML+GAAKIL+     L+GTV+LIFQPAEE  +GAK M  +GAL++VEAIF +H+S   P G   S  G  +AG G F
Sbjct:   38 LELAKSPEVFDSMVRIRRKIHENPELGYEEFETSKFIRSELDLIGVKYRFPVAITGIIGYIGTGEPPFVALRADMDALPIQEAVEWEHKSKNPGKMHACGHDGHVAMLLGAAKILQQHRQHLQGTVVLIFQPAEEGLSGAKMMREEGALKNVEAIFGIHLSPRTPFGKAASLAGSFMAGAGAF 220          
The following BLAST results are available for this feature:
BLAST of FC877780 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
ILL6_ARATH5.415e-9078.97IAA-amino acid hydrolase ILR1-like 6 OS=Arabidopsi... [more]
ILL6_ORYSJ6.866e-7774.19IAA-amino acid hydrolase ILR1-like 6 OS=Oryza sati... [more]
ILL2_ORYSJ4.766e-7067.57IAA-amino acid hydrolase ILR1-like 2 OS=Oryza sati... [more]
ILL1_ORYSJ6.029e-6562.50IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sati... [more]
ILL1_ORYSI1.754e-6461.96IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sati... [more]
ILL2_ARATH2.533e-6361.08IAA-amino acid hydrolase ILR1-like 2 OS=Arabidopsi... [more]
ILL4_ARATH1.642e-6260.66IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsi... [more]
ILR1_ARATH1.177e-6055.39IAA-amino acid hydrolase ILR1 OS=Arabidopsis thali... [more]
ILL5_ARATH1.301e-5959.14IAA-amino acid hydrolase ILR1-like 5 OS=Arabidopsi... [more]
ILL1_ARATH1.301e-5960.66IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsi... [more]

Pages

back to top
Libraries
Library NameType
IVIA1cdna_library
Properties
Property NameValue
Genbank descriptionIC0AAA74DD12RM1 IVIA1 Citrus clementina cDNA clone IC0AAA74DD12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877780 ID=FC877780|Name=FC877780|organism=Citrus clementina|type=EST|length=828bp
TTTCTCTGCAAACATGAAGCTTCAAAAACTCTCTGTGGCGTTTAAAATCT
TGAGCTTCAATTTAATTATTATTATTCTCCTGCAAGTTGAATCCTTAACG
CCGGCGAACAACGACTACGCTTTCTTTGACATAAACTCGTTGGGCTCATC
AACAATAGCAGCAACAACGCCGGCTTGGAAACCCGACGGCGGCAGCGTCA
AGAACCGATCGTCGACGTCACGGAAGCCGTTTTCGAGCTGCGGAGTGTGG
AGCAGGGCGTGCTCGAAGGAGGTGATGGAGCTGGCGCGGCGGCCGGAGAC
GGTGGATTGGCTGAGGAGTGTGAGGAGAACGATTCATCAGAATCCGGAGC
TTGCTTTTCAAGAATTTGAAACCAGCAGGCTCTTGAGGGCCGAGTTGGAT
CGGATGGAGATTGGATACAAATACCCGTTGGCCAAAACAGGTATCCGGGC
ATGGGTCGGGACAGGCGGACCGCCGTTTGTTGCCCTCAGAGCTGACATGG
ATGCACTTCCGATTCAGGAAGCCGTCGAGTGGGAATACAAAAGCAAAGTG
GCTGGCAAAATGCATGCCTGTGGACACGATGCGCACGTTGCCATGCTCAT
CGGTGCGGCCAAGATCTTGAAGAGCCGCGAACATCTTTTAAAGGGAACTG
TAATCTTGATATTCCAGCCAGCGGAGGAAGCTGGCAATGGTGCAAAAAGG
ATGATGGCTGATGGGGCTCTAGAAGATGTCGAGGCAATATTCGCCGTTCA
CGTGTCCCACGAGCATCCTACCGGTGTCATTGGTTCCAGGCCAGGTCCTT
TGCTAGCCGGCTGTGGCTTTTTCCATGC
back to top