FC877785

Overview
NameFC877785
Unique NameFC877785
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length865
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC877785_ssr166 microsatellite FC877785_ssr166:166..177. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2341 contig Ccv1_Contig2341:5..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877785 vs. ExPASy Swiss-Prot
Match: MCM4B_XENLA (DNA replication licensing factor mcm4-B OS=Xenopus laevis GN=mcm4-B PE=1 SV=3)

HSP 1 Score: 112.849 bits (281), Expect = 2.481e-24
Identity = 59/202 (29.21%), Postives = 100/202 (49.50%), Query Frame = 1
Query:  259 TPSRSNRRSNGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFRXXXXXXXXXXXXIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINP--LFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMIIRCSSIIPEIREAIFRCLVCGY 858
            TP+R        R         D P +      +        +WGT+++V   K   Q F++ F                E  YM+ +  +  +   ++++D + + ++D DLY ++V YP EV+  FD+   +I     P  + E  +QVR YN   +  MR+LNP DI++++++ GM+IR S IIPE++EA F+C VC +
Sbjct:  110 TPARQRPDLGSARKVKQVDLHSDQPAAEELVTSEQSLGQKLVIWGTDVNVATCKEKFQRFVQRFIDPSAKEEDNVGLDLNEPIYMQRLEEINVVGDPFLNIDCDHLRNFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAF 311          
BLAST of FC877785 vs. ExPASy Swiss-Prot
Match: MCM4_XENTR (DNA replication licensing factor mcm4 OS=Xenopus tropicalis GN=mcm4 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 3.240e-24
Identity = 60/202 (29.70%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  259 TPSRSNRRSNGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFRXXXXXXXXXXXXIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINP--LFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMIIRCSSIIPEIREAIFRCLVCGY 858
            TP+R        R         D P +      +        +WGT+++V   K   Q F++ F                E  YM+ +  +  +   +++VD + +  +D DLY ++V YP EV+  FD+   +I     P  + E  +QVR YN   +  MR+LNP DI++++++ GM+IR S IIPE++EA F+C VC +
Sbjct:  110 TPARQRPDLGSARKVKQVDLHSDQPAAEELVTSEQSLGQKLVIWGTDVNVATCKEKFQRFVQRFIDPLAKEEENVGLDLNEPIYMQRLEEINVVGEPFLNVDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAF 311          
BLAST of FC877785 vs. ExPASy Swiss-Prot
Match: MCM4_SCHPO (DNA replication licensing factor mcm4 OS=Schizosaccharomyces pombe GN=mcm4 PE=1 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 9.428e-24
Identity = 65/238 (27.31%), Postives = 126/238 (52.94%), Query Frame = 1
Query:  205 TPRANQSRFATSSETPNTTPSRSNRRSNGQRHATSPSS-----TDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFRXXXXXXXXXXXXIYKEGK---YMRAINRVLEIEGEWIDVDANDVFDYD--SDLYNKMVRYPLEVLAIFDIVLMDIV----------SLINPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMIIRCSSIIPEIREAIFRCLVCGY 858
            TPR+ + R    S    +TPSR       +   ++PSS     +D +  S +    ++ + T   +WGTN+S+Q+  ++ + FL+ F+               + +   Y+ A+  +  +  E +++D  D+  Y     LY+++  YP E++ I D  + D++           ++N +  K  ++R +NL+    MR+LNP DI+K++S+KG+++RC+ +IP++++A FRC VCG+
Sbjct:   95 TPRSTR-RGDIHSSVQMSTPSRRREVDPQRPGVSTPSSLLFSGSDALTFSQAHPSSEVADDTVRVIWGTNVSIQESIASFRGFLRGFKKKYRPEYRNELMPPPDAEQLVYIEALRNMRIMGLEILNLDVQDLKHYPPTKKLYHQLYSYPQEIIPIMDQTIKDVMLDLLGTNPPEDVLNDIELKIYKIRPFNLEKCINMRDLNPGDIDKLISIKGLVLRCTPVIPDMKQAFFRCSVCGH 331          
BLAST of FC877785 vs. ExPASy Swiss-Prot
Match: MCM4A_XENLA (DNA replication licensing factor mcm4-A OS=Xenopus laevis GN=mcm4-A PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.231e-23
Identity = 58/202 (28.71%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  259 TPSRSNRRSNGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFRXXXXXXXXXXXXIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINP--LFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMIIRCSSIIPEIREAIFRCLVCGY 858
            TP+R        R         D P +      +        +WGT+++V   K   Q F++ F                E  YM+ +  +  +   ++++D + +  +D DLY ++V YP EV+  FD+   +I     P  + E  +QVR YN   +  MR+LNP DI++++++ GM+IR S IIPE++E+ F+C VC +
Sbjct:  105 TPARQRADLGSARKVKQVDLHSDQPAAEELVTSEQSLGQKLVIWGTDVNVAICKEKFQRFVQRFIDPLAKEEENVGLDLNEPIYMQRLEEINVVGEPFLNIDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQESFFKCQVCAF 306          
BLAST of FC877785 vs. ExPASy Swiss-Prot
Match: MCM4_DROME (DNA replication licensing factor MCM4 OS=Drosophila melanogaster GN=dpa PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 4.679e-23
Identity = 57/188 (30.32%), Postives = 102/188 (54.26%), Query Frame = 1
Query:  313 SSTDDVPLSSSEAGDDMDEATPT---FVWGTNISVQDVKSAIQMFLKHFRXXXXXXXXXXXXI-YKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINP--LFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMIIRCSSIIPEIREAIFRCLVCGY 858
            S  + +P   SE  D + E++      VWGTN+ V   KS  + F+  F             I   +  Y++ +  +  +E  +++++   +  +D DLY +++ YP EV+  FD+ + ++     P  L E  +QVR +N   +  MR+LNP D+++++S+ GM+IR S++IPE+REA F C +C +
Sbjct:  127 SGLEPIPEKGSETTDPVSESSQAPQLVVWGTNVVVSQCKSKFKSFIMRFIDPSAEQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFERYPAALLEHQIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSF 314          
BLAST of FC877785 vs. ExPASy Swiss-Prot
Match: MCM4_HUMAN (DNA replication licensing factor MCM4 OS=Homo sapiens GN=MCM4 PE=1 SV=5)

HSP 1 Score: 106.686 bits (265), Expect = 1.778e-22
Identity = 55/184 (29.89%), Postives = 98/184 (53.26%), Query Frame = 1
Query:  313 SSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFRXXXXXXXXXXXXIYKEGKYMRAINRVLEIEGEWIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINP--LFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMIIRCSSIIPEIREAIFRCLVCGY 858
            ++ +D+  S    G  +       +WGT+++V   K   Q FL+ F                E  YM+ +  +  I   +++V+   +  +D +LY +++ YP EV+  FD+ + +I     P  + E  +QVR +N   +  MRNLNP DI++++++ GM+IR S +IPE++EA F+C VC +
Sbjct:  134 AAAEDIVASEQSLGQKL------VIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAH 311          
BLAST of FC877785 vs. ExPASy Swiss-Prot
Match: MCM4_MOUSE (DNA replication licensing factor MCM4 OS=Mus musculus GN=Mcm4 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.380e-21
Identity = 52/161 (32.30%), Postives = 92/161 (57.14%), Query Frame = 1
Query:  385 VWGTNISVQDVKSAIQMFLKHFRXXXXXXXXXXXXIYKEGKYMRAINRVLEIEGE-WIDVDANDVFDYDSDLYNKMVRYPLEVLAIFDIVLMDIVSLINP--LFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMIIRCSSIIPEIREAIFRCLVCGY 858
            +WGT+++V   K   Q FL+ F                +  YM+ +  +  I GE +++V+   +  +  +LY +++ YP EV+  FD+ + +I     P  + E  +QVR +N   + +MRNLNP DI++++++ GM+IR S +IPE++EA F+C VC +
Sbjct:  151 IWGTDVNVATCKENFQRFLQCFTDPLAKEEENVGIDITQPLYMQQLGEI-NITGEPFLNVNCEHIKSFSKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKSMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAH 310          
BLAST of FC877785 vs. ExPASy Swiss-Prot
Match: CDC54_YEAST (Cell division control protein 54 OS=Saccharomyces cerevisiae GN=CDC54 PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 5.720e-21
Identity = 60/199 (30.15%), Postives = 107/199 (53.77%), Query Frame = 1
Query:  313 SSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQDVKSAIQMFLKHFRXXXXXXXXXXXXIY-----KEGKYMRAINRVLEIEGEWIDVDANDVFDYDS--DLYNKMVRYPLEVLAIFDIVLMD-IVSLI---------NPLFEKHVQVRIYNLKSSTAMRNLNPSDIEKMVSLKGMIIRCSSIIPEIREAIFRCLVCGY 858
            S  + +  SSS A           +WGTN+S+Q+  +  + FL  F+                   +E  Y++ +N + E+    +++DA ++  Y    DLY++++ YP EV++I D  + D +VSLI         + +  K  +VR YN+ S   MR LNP+DI+K+++LKG+++R + +IP+++ A F+C VC +
Sbjct:  156 SGVNTLDTSSSSAPPSEASEPLRIIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDH 354          
The following BLAST results are available for this feature:
BLAST of FC877785 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
MCM4B_XENLA2.481e-2429.21DNA replication licensing factor mcm4-B OS=Xenopus... [more]
MCM4_XENTR3.240e-2429.70DNA replication licensing factor mcm4 OS=Xenopus t... [more]
MCM4_SCHPO9.428e-2427.31DNA replication licensing factor mcm4 OS=Schizosac... [more]
MCM4A_XENLA1.231e-2328.71DNA replication licensing factor mcm4-A OS=Xenopus... [more]
MCM4_DROME4.679e-2330.32DNA replication licensing factor MCM4 OS=Drosophil... [more]
MCM4_HUMAN1.778e-2229.89DNA replication licensing factor MCM4 OS=Homo sapi... [more]
MCM4_MOUSE4.380e-2132.30DNA replication licensing factor MCM4 OS=Mus muscu... [more]
CDC54_YEAST5.720e-2130.15Cell division control protein 54 OS=Saccharomyces ... [more]
back to top
Properties
Property NameValue
Genbank descriptionIC0AAA58BG01RM1 IVIA1 Citrus clementina cDNA clone IC0AAA58BG01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877785 ID=FC877785|Name=FC877785|organism=Citrus clementina|type=EST|length=865bp
CCTCTCCCTCGCATTCAGTCAGTAACCATGGCGTCTGATTCAGGCTTCCC
CAGCTTCAACGACGGGCCGTCGTCCCCGGACGATTCAATTTCAACTCCAA
TCGACAACACCTTCTCCTCTCCAGCCGGCTCCTCACGCGCCTCCGGTCGC
GGTCGTGGTGGCGGACGCCGCCGCCGCCGATCCACGACACCGACAGCCTT
CCTTACGCCACGGGCAAACCAATCCCGCTTCGCCACTTCCTCTGAAACCC
CAAACACCACGCCATCCCGCTCAAACCGCAGATCCAACGGTCAAAGACAC
GCCACGTCGCCGTCCTCAACCGACGATGTCCCACTATCGTCCTCTGAGGC
CGGCGACGACATGGACGAGGCCACGCCGACGTTCGTATGGGGCACGAACA
TTAGCGTGCAAGACGTTAAAAGCGCTATACAAATGTTCTTGAAGCATTTT
AGAGAGAAAGAAGAGCTGCTGAGTGGAAGTGAGAGTGAGATTTATAAAGA
GGGGAAGTATATGAGAGCTATAAATAGGGTTCTTGAAATTGAAGGAGAGT
GGATTGATGTTGATGCAAATGATGTGTTTGATTATGATTCCGACTTGTAT
AACAAAATGGTTCGATACCCACTTGAGGTTTTGGCAATTTTCGATATTGT
GTTGATGGATATTGTTAGTTTGATTAACCCCTTGTTTGAAAAGCATGTGC
AAGTAAGGATTTATAATCTTAAGAGCTCCACTGCAATGCGAAATCTCAAC
CCATCAGATATCGAGAAGATGGTATCATTAAAGGGAATGATTATTCGGTG
TAGTTCGATAATACCAGAGATTAGGGAGGCTATATTTAGGTGTCTTGTAT
GTGGGTACTACTCGG
back to top