FC877787

Overview
NameFC877787
Unique NameFC877787
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length873
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12081 contig Ccv1_Contig12081:125..997. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877787 vs. ExPASy Swiss-Prot
Match: FLA17_ARATH (Fasciclin-like arabinogalactan protein 17 OS=Arabidopsis thaliana GN=FLA17 PE=2 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 4.354e-101
Identity = 197/296 (66.55%), Postives = 226/296 (76.35%), Query Frame = 1
Query:    1 FIFPLQLTASMQLQGNNA--THSGQINSNSVLVALLDSHYTELSELVEKALLLQPLEDAVGKHSITIFAPKNEALERDLDPEFKRFLLEPGNLKSLQTLLLHHIVSTRIELNRTATEST---QHHTLSSDSVELTSHDSGDKFISQSKVIHPNAVDRPDGVIHGIERLLIPRSVQQDFNNRRNLRSISAVRPEGAPEVDPRTNRLKKPTPASKPGSSPALPVYYAMXXXXXXXXXXXXXXXXXHHHFNGEKQVKDFIQTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL 873
            F   L  +A+  L  N +  + SGQINSNSVLVALLDS YTEL+ELVEKALLLQ LEDAVG+H+ITIFAP+NEALERDLDPEFKRFLLEPGNLKSLQTLL+ HI+  R+  N+  +E +   +HHTL +D V L S+  G K +  +++I P+ + RPDG+IHGIERLLIPRSVQ+DFN RR+L+SISAV PEGAPEVDPRTNRLKKP      GS PALP+  AM                  HHF+GE QVKDFI TLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL
Sbjct:   17 FFSVLIFSAASALSKNQSPSSGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNEALERDLDPEFKRFLLEPGNLKSLQTLLMFHIIPNRVGSNQWPSEESGRVKHHTLGNDQVRL-SNGQGKKMVDLAEIIRPDDLTRPDGLIHGIERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPAAPVPAGSPPALPIQSAMAPGPSLAPAPAPGPGGKQHHFDGEAQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL 311          
BLAST of FC877787 vs. ExPASy Swiss-Prot
Match: FLA18_ARATH (Fasciclin-like arabinogalactan protein 18 OS=Arabidopsis thaliana GN=FLA18 PE=2 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.449e-96
Identity = 197/300 (65.67%), Postives = 223/300 (74.33%), Query Frame = 1
Query:    1 FIFPLQLTASMQLQGN-NATHSGQINSNSVLVALLDSHYTELSELVEKALLLQPLEDAVGKHSITIFAPKNEALERDLDPEFKRFLLEPGNLKSLQTLLLHHIVSTRIELNRTATEST---QHHTLSSDSVELTSH---DSGDKFISQSKVIHPNAVDRPDGVIHGIERLLIPRSVQQDFNNRRNLRSISAVRPEGAPEVDPRTNRLKK-PTPASKP-GSSPALPVYYAMXXXXXXXXXXXXXXXXXHHHFNGEKQVKDFIQTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL 873
            F F   L AS    G+ N T SGQINSNSVLVALLDS YTEL+ELVEKALLLQ LEDAVG+H+ITIFAP+NEALERDLDP+FKRFLL+PGNLKSLQTLLL HI+  R+  N+   E++   +H TL  D V   S     +G + ++ + +  P+ + RPDG+IHGIERLLIPRSVQ+DFN RRNLRSISAV PEGAPE+DPRTNRLKK  T  S P GS P LP+  AM                 H HFNG+ QVKDFI TLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL
Sbjct:   15 FSFFFLLNASALESGHHNITGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNEALERDLDPDFKRFLLQPGNLKSLQTLLLSHIIPKRVGSNQWPEENSGRVKHVTLGHDQVLHLSKLKGTNGKRLVNSAVITRPDDLTRPDGLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKKSATAVSVPAGSPPVLPIESAMAPGPSLAPAPAPGPGGAHKHFNGDAQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL 314          
BLAST of FC877787 vs. ExPASy Swiss-Prot
Match: FLA16_ARATH (Fasciclin-like arabinogalactan protein 16 OS=Arabidopsis thaliana GN=FLA16 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 5.508e-96
Identity = 191/292 (65.41%), Postives = 220/292 (75.34%), Query Frame = 1
Query:    1 FIFPLQLTASMQLQ-GNNATHSGQINSNSVLVALLDSHYTELSELVEKALLLQPLEDAVGKHSITIFAPKNEALERDLDPEFKRFLLEPGNLKSLQTLLLHHIVSTRIELNRTATESTQHHTLSSDSVELTSHDSGDKFISQSKVIHPNAVDRPDGVIHGIERLLIPRSVQQDFNNRRNLRSISAVRPEGAPEVDPRTNRLKKPTPASKPGSSPALPVYYAMXXXXXXXXXXXXXXXXXHHHFNGEKQVKDFIQTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL 873
            F+  L LT S+     +N    GQINSNSVLVALLDSHYTEL+ELVEKALLLQ LE+AVGKH+ITIFAP+N+ALER+LDP FK FLLEP NLKSLQ+LL+ HI+  RI   +  + S  H TLS+D + LT  D     +  +++I P+ V RPDG+IHGIERLLIPRSVQ+DFN RR+LRSISAV PEGAPEVDPRT+RLKKP+PA   G+ P LP+Y AM                   HFNG+ QVKDFI TLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL
Sbjct:   10 FLLLLFLTTSIATALPDNKPVPGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNDALERNLDPLFKSFLLEPRNLKSLQSLLMFHILPKRITSPQWPSLSHHHRTLSNDHLHLTV-DVNTLKVDSAEIIRPDDVIRPDGIIHGIERLLIPRSVQEDFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPSPAVPAGAPPVLPIYDAMSPGPSLAPAPAPGPGGPRGHFNGDAQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL 300          
BLAST of FC877787 vs. ExPASy Swiss-Prot
Match: FLA15_ARATH (Fasciclin-like arabinogalactan protein 15 OS=Arabidopsis thaliana GN=FLA15 PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 6.733e-94
Identity = 183/290 (63.10%), Postives = 217/290 (74.83%), Query Frame = 1
Query:    4 IFPLQLTASMQLQGNNATHSGQINSNSVLVALLDSHYTELSELVEKALLLQPLEDAVGKHSITIFAPKNEALERDLDPEFKRFLLEPGNLKSLQTLLLHHIVSTRIELNRTATESTQHHTLSSDSVELTSHDSGDKFISQSKVIHPNAVDRPDGVIHGIERLLIPRSVQQDFNNRRNLRSISAVRPEGAPEVDPRTNRLKKPTPASKPGSSPALPVYYAMXXXXXXXXXXXXXXXXXHHHFNGEKQVKDFIQTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL 873
            +F L LT S+     +   SGQINSNSVLVALLDSHYTEL+ELVEKALLLQ LE+AVG+H+ITIFAP+N+ALE++LDPEFK FLL+P NLKSLQ+LL+ HI+  RI   + ++    H TLS+D +  T+       ++ +++  P+ + RPDG+IHGIERLLIPRSVQ+DFN RR+LRSI+AV PEGAPEVDPRT+RLKK       G+ P LPVY AM                  HHFNGE QVKDFI TLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL
Sbjct:    8 LFFLLLTISITTALPDKPGSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGQHNITIFAPRNDALEKNLDPEFKSFLLQPKNLKSLQSLLMFHILPKRITSPQFSSAVVSHRTLSNDHLHFTNGK-----VNSAEITKPDDLTRPDGIIHGIERLLIPRSVQEDFNRRRSLRSIAAVLPEGAPEVDPRTHRLKKKPAPIPAGAPPVLPVYDAMSPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL 292          
The following BLAST results are available for this feature:
BLAST of FC877787 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
FLA17_ARATH4.354e-10166.55Fasciclin-like arabinogalactan protein 17 OS=Arabi... [more]
FLA18_ARATH1.449e-9665.67Fasciclin-like arabinogalactan protein 18 OS=Arabi... [more]
FLA16_ARATH5.508e-9665.41Fasciclin-like arabinogalactan protein 16 OS=Arabi... [more]
FLA15_ARATH6.733e-9463.10Fasciclin-like arabinogalactan protein 15 OS=Arabi... [more]
back to top
Libraries
Library NameType
IVIA1cdna_library
Properties
Property NameValue
Genbank descriptionIC0AAA96BA10RM1 IVIA1 Citrus clementina cDNA clone IC0AAA96BA10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877787 ID=FC877787|Name=FC877787|organism=Citrus clementina|type=EST|length=873bp
TTTATATTCCCTCTCCAACTCACGGCTTCAATGCAATTGCAAGGAAACAA
CGCAACTCACTCTGGCCAAATCAACTCCAACTCAGTCCTGGTCGCACTTC
TCGACTCGCATTACACCGAACTCTCTGAGCTCGTCGAGAAAGCTCTCCTC
TTGCAGCCACTCGAAGATGCTGTCGGCAAGCACAGCATCACCATTTTCGC
TCCCAAAAATGAAGCTTTGGAGCGGGATCTCGATCCCGAGTTCAAGCGCT
TCTTGCTCGAGCCAGGCAACTTGAAGTCTCTTCAGACGCTTTTGCTTCAT
CACATTGTCTCCACGCGAATAGAGTTAAACCGGACTGCCACCGAGTCAAC
TCAGCATCATACACTGTCCAGTGATTCAGTCGAGCTAACGAGTCATGATT
CGGGTGATAAATTTATAAGTCAATCCAAGGTCATTCATCCGAACGCCGTG
GACCGTCCAGATGGAGTCATCCACGGCATCGAACGGCTGCTAATCCCTCG
ATCCGTACAGCAAGATTTCAACAACCGAAGGAATCTCCGTTCAATCTCAG
CCGTTAGACCGGAAGGAGCACCAGAGGTCGACCCGAGGACAAACCGGTTG
AAGAAACCGACACCAGCCTCCAAACCCGGCTCATCTCCGGCCCTTCCGGT
TTACTACGCAATGGCTCCCGGTCCTTCACTAGCTCCGGCCCCGGCACCAG
GGCCGGGCGGGCCGCACCACCACTTCAACGGAGAGAAGCAAGTGAAGGAT
TTCATCCAAACGCTTTTACACTACGGCGGGTACAACGAAATGGCCGATAT
TTTAGTGAATCTGACGTCGCTGGCAACGGAAATGGGGCGGCTTGTGTCGG
AGGGATATGTTTTGACGGTATTG
back to top