FC877788

Overview
NameFC877788
Unique NameFC877788
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC877788_ssr299 microsatellite FC877788_ssr299:299..308. BLAST: Citrus ESTs to Prunus persica proteins V1
FC877788_ssr450 microsatellite FC877788_ssr450:450..461. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10460 contig Ccv1_Contig10460:1..878. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877788 vs. ExPASy Swiss-Prot
Match: K502_ACTDE (Fruit protein pKIWI502 OS=Actinidia deliciosa GN=pKIWI502 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.239e-31
Identity = 77/198 (38.89%), Postives = 120/198 (60.61%), Query Frame = 1
Query:  298 TLSLKPNMALALSPSPSLPHAHVSQTFPPMSILRRISLLNLKPQRRHLATLAAA-----AVRQDTTVWTPAPLVEISPAA-ESLFHISIDISDAPDIGSSHTRAGQYLQLRVADV-----GKPTFLAVXXXXXXXXXXXXXEFLVKSVAGSTAEVLCGLKKGDVVEISQVMGRGFDVDRIQPPDEYPTVLIFATGSGI 858
            +LS  P++ L  S S + PH        P++ LR  +L      R  L ++A+A     A+RQDT +WTP P+  + PAA ESLF + +D+S +PD+  +    GQY+Q+R+ +       +P +  +             EFL++SV G+T+EVLC LK+GDVV+++Q++GRGFD+++I PP++YPTVLI  TG G+
Sbjct:   14 SLSRHPSLTLHSSLSHAPPHHR------PVAFLRHPTLRYHHHGR--LLSVASAILQDTAIRQDTYIWTPVPISRVLPAAAESLFKVIVDLSRSPDLVYNFVSPGQYVQIRIPEAIVNPPPRPAYFYIASPPSLVKKNLEFEFLIRSVPGTTSEVLCSLKEGDVVDLTQIIGRGFDIEQILPPEDYPTVLISVTGYGM 203          
The following BLAST results are available for this feature:
BLAST of FC877788 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
K502_ACTDE6.239e-3138.89Fruit protein pKIWI502 OS=Actinidia deliciosa GN=p... [more]
back to top
Libraries
Library NameType
IVIA1cdna_library
Properties
Property NameValue
Genbank descriptionIC0AAA50AA11RM1 IVIA1 Citrus clementina cDNA clone IC0AAA50AA11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877788 ID=FC877788|Name=FC877788|organism=Citrus clementina|type=EST|length=878bp
ATGAGCTGTTTGATAATGAGCAATTAAGGAAAGAAAAGAGAAAACGATAA
AATTTCAATGGTCATAATTAAGTAATTAACCTATAAAAGTTTATCGTACG
GCGGATCAATCCCAAAAGCTTTCACTACTTATCTCCGCCAATGCAGGATC
CTTCATCCATTATGACACGTGGAAGTCGTCCAACCGTCCCCCGAATTTCA
CATCGATGCCTCAGATGAAGCGCCACCTCATCACGAGCCCGACCACCTTT
AGCGCCGGCATTCTCTAGTCTGCGCCAACAAACACTGACTGACATATACT
CTCTCTCTAAAACCAAACATGGCCCTTGCTCTCTCTCCATCACCCTCCTT
GCCCCATGCACACGTTAGCCAAACCTTCCCTCCCATGTCTATCCTACGCC
GCATTTCATTACTTAACCTAAAACCCCAACGACGCCACCTCGCCACCCTC
GCCGCCGCCGCCGTACGCCAAGACACCACTGTCTGGACACCCGCCCCGCT
CGTCGAGATCTCTCCCGCTGCTGAGTCGCTCTTCCACATATCTATCGACA
TCTCCGACGCACCCGACATCGGGTCTTCCCACACACGTGCGGGTCAATAC
CTTCAGCTCCGTGTTGCTGACGTGGGAAAGCCTACTTTCCTTGCTGTTGC
TTCTCCGCCGTCTTTTGCTTCTGCGAGTGGCGCGTTTGAGTTCCTTGTGA
AGAGCGTGGCTGGCTCGACGGCCGAGGTTTTGTGTGGATTGAAGAAAGGT
GATGTTGTTGAGATAAGTCAAGTTATGGGGAGAGGATTCGATGTCGATCG
AATCCAGCCGCCGGATGAGTATCCTACGGTTTTGATTTTTGCTACCGGAT
CGGGAATCAGGAACTGCTTCTGTGCTTC
back to top