FC877789

Overview
NameFC877789
Unique NameFC877789
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length879
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig2526 contig Ccv1_Contig2526:171..1049. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877789 vs. ExPASy Swiss-Prot
Match: LRKA3_ARATH (Lectin-domain containing receptor kinase A4.3 OS=Arabidopsis thaliana GN=LECRKA4.3 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.390e-30
Identity = 87/268 (32.46%), Postives = 133/268 (49.63%), Query Frame = 2
Query:  122 FIYNGFRS--ANLSLDGIAQFTSNGLLKLTNETKQQIGHAFYPEPIPFKXXXXXXXTANGXXXXXXXXXXXXIRSEFQSILSGHGIAFVIAPTRGLPGARPSQYLGLFNESNLGNETNHVFAVELDTIESHEFFDIND---NHVGIDINSLKSEISYPAGYYGDH---FVNLTLISGRPMQVWVEYDGLEKRTDVTLAPINI---PKXXXXXXXXXXXXXXXXNDAMYVGFSSSTG--SVLVSHYILGWSFKINGQ---AQELHLSQL 877
            FI++GF+   + + + G +  TSNGLL+LT+     +G AFY +P+          T                 S       G G  F ++PT     A P QY+GL NE N GN +NHVFAVE DT++   F D  +   NH+G++ NSL S++  P  Y+ ++        L+SG P+QV+++Y G  K  ++T+ P  +   P+                 D M+VGF+++TG      +HY++GWSF   G+   A  L +SQL
Sbjct:   30 FIFHGFKGNQSEIHMQGDSTITSNGLLRLTDRNSDVVGTAFYHKPVRLLDSNSTNTTVRSFSTSFIFIIPSSSTSN-----GGFGFTFTLSPTPNRTDADPEQYMGLLNERNDGNSSNHVFAVEFDTVQG--FKDGTNRIGNHIGLNFNSLSSDVQEPVAYFNNNDSQKEEFQLVSGEPIQVFLDYHGPTKTLNLTVYPTRLGYKPRIPLISREVPKLSDIVV-DEMFVGFTAATGRHGQSSAHYVMGWSFASGGEHPLAAMLDISQL 289          
BLAST of FC877789 vs. ExPASy Swiss-Prot
Match: LRKA2_ARATH (Lectin-domain containing receptor kinase A4.2 OS=Arabidopsis thaliana GN=LECRKA4.2 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 4.943e-28
Identity = 80/252 (31.75%), Postives = 121/252 (48.02%), Query Frame = 2
Query:  122 FIYNGF--RSANLSLDGIAQFTSNGLLKLTNETKQQIGHAFYPEPIPFKXXXXXXXTANGXXXXXXXXXXXXIRSEFQSILSGHGIAFVIAPTRGLPGARPSQYLGLFNESNLGNETNHVFAVELDTIES-HEFFDINDNHVGIDINSLKSEISYPAGYYGDHFVN----LTLISGRPMQVWVEYDGLEKRTDVTLAPINIPK--XXXXXXXXXXXXXXXXNDAMYVGFSSSTGSVLVS-HYILGWSFKING 847
            FI+ GF    +N+   G A    +GLL+LT+      G +FY +P+          ++              +     S   G G  F ++PT    GA  +QYLGL N++N GN TNHVFAVE DT++   +  D   NH+G++ NSL S++  P  YY +   N      L SG P++  ++YDG  +  ++T+ P N+                     + MYVGF+++TG    S HY++GWSF   G
Sbjct:   26 FIFRGFSGNQSNIVTTGAATIKLDGLLRLTDRNSNVTGTSFYHKPVRL---LETNTSSTNSTIRSFSTSFVFVIIPTSSSNGGFGFTFTLSPTPDRTGAESAQYLGLLNKANDGNSTNHVFAVEFDTVQGFKDGADRTGNHIGLNFNSLTSDVQEPVVYYDNEDPNRKEDFPLQSGDPIRAILDYDGPTQTLNLTVYPANLKSRPVRPLISRPVPKLSQIVQEEMYVGFTAATGRDQSSAHYVMGWSFSSGG 274          
BLAST of FC877789 vs. ExPASy Swiss-Prot
Match: LRKA1_ARATH (Lectin-domain containing receptor kinase A4.1 OS=Arabidopsis thaliana GN=LECRKA4.1 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.031e-25
Identity = 84/272 (30.88%), Postives = 123/272 (45.22%), Query Frame = 2
Query:  104 QDKNPSFIYNGFRS--ANLSLDGIAQFTSNGLLKLTNETKQQIGHAFYPEPIPFKXXXXXXXTANGXXXXXXXXXXXXIRSEFQSILSGHGIAFVIAPTRGLPGARPSQYLGLFNESNLGNETNHVFAVELDTIES--HEFFDINDNHVGIDINSLKSEISYPAGYYGDHFVN----LTLISGRPMQVWVEYDGLEKRTDVTLAP--INIPKXXXXXXXXXXXXXXXXNDAMYVGFSSSTGSVLVS-HYILGWSFKINGQ---AQELHLSQL 877
            Q    +F + GF    + + ++G A    +GLL+LT+      G AFY +P+          T                 S       G G  F ++PT     A  +QYLG+FN+ N G+  NHVFAVE DT++    +  D   N +G++ NS  S++  P  YY +   N      L SG P+Q  +EYDG  +  +VT+ P  +                     + MYVGF++STG    S HY++GWSF   G+   A  L LS+L
Sbjct:   27 QRTTTNFAFRGFNGNQSKIRIEGAAMIKPDGLLRLTDRKSNVTGTAFYHKPVRLLNRNSTNVTIRSFSTSFVFVIIPSSSSN-----KGFGFTFTLSPTPYRLNAGSAQYLGVFNKENNGDPRNHVFAVEFDTVQGSRDDNTDRIGNDIGLNYNSRTSDLQEPVVYYNNDDHNKKEDFQLESGNPIQALLEYDGATQMLNVTVYPARLGFKPTKPLISQHVPKLLEIVQEEMYVGFTASTGKGQSSAHYVMGWSFSSGGERPIADVLILSEL 293          
BLAST of FC877789 vs. ExPASy Swiss-Prot
Match: LEC2_CLALU (Agglutinin-2 OS=Cladrastis lutea PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.366e-11
Identity = 70/262 (26.72%), Postives = 106/262 (40.46%), Query Frame = 2
Query:  119 SFIYNGFR--SANLSLDGIAQFTSNG-LLKLTNE------TKQQIGHAFYPEPIPFKXXXXXXXTANGXXXXXXXXXXXXIRSEFQSILS------GHGIAFVIAPTRG-LPGARPSQYLGLFNESN-LGNETNHVFAVELDTIESHEFFDINDNHVGIDINSLKSEISYPAGYYGDHFVNLTLISGRPMQVWVEYDGLEKRTDVTLAPINIPKXXXXXXXXXXXXXXXXNDAMYVGFSSSTGSVLVSHYILGWSFKINGQA 853
            SF ++ FR    +L L G A+ +S G  L+LT         +  +G A Y  P+           +               ++ F  +LS      G GIAF IAP    +P       LGLF+  N L N  N + AVE DT  ++ + D +  H+GID+N++KS  +          V     +G      + Y+   K+  V  +  N                    + + VGFS STG  + +H IL W+F  N Q+
Sbjct:   40 SFTFDNFRPDQRDLILQGDAKISSGGDSLQLTKTDTSGKPVRGSVGRALYYTPLHLWDSSTNRLAS--------------FQTTFTFVLSSPTNNPGDGIAFFIAPPETTIPPGSSGGLLGLFSPDNALNNSLNQIVAVEFDTFVNNNW-DPSHRHIGIDVNTIKSSAT----------VRWQRENGSLATAQISYNSDTKKLSVVSSYPNTQANEDYTVSYDVDLKTELPEWVRVGFSGSTGGYVQNHNILSWTFNSNLQS 276          
The following BLAST results are available for this feature:
BLAST of FC877789 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
LRKA3_ARATH1.390e-3032.46Lectin-domain containing receptor kinase A4.3 OS=A... [more]
LRKA2_ARATH4.943e-2831.75Lectin-domain containing receptor kinase A4.2 OS=A... [more]
LRKA1_ARATH1.031e-2530.88Lectin-domain containing receptor kinase A4.1 OS=A... [more]
LEC2_CLALU9.366e-1126.72Agglutinin-2 OS=Cladrastis lutea PE=1 SV=1[more]
back to top
Libraries
Library NameType
IVIA1cdna_library
Properties
Property NameValue
Genbank descriptionIC0AAA24CC04RM1 IVIA1 Citrus clementina cDNA clone IC0AAA24CC04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877789 ID=FC877789|Name=FC877789|organism=Citrus clementina|type=EST|length=879bp
CAAGAGATAAGCCATGGCCTTCAAGCTTCCAATACCACTGGTGTCTCTCC
TGACCATCATAATCATCATCACCACTAGCTCAGCAGCAACGGCAGCAGCA
GCCCAAGATAAAAATCCAAGTTTCATCTACAACGGATTCCGTTCAGCCAA
CCTAAGCCTGGACGGGATAGCACAATTCACCTCCAATGGACTCCTGAAGC
TAACCAACGAGACCAAACAACAAATTGGCCATGCCTTTTACCCTGAACCA
ATACCCTTCAAAAACAACAACAGCAACTCATCAACAGCAAACGGCACCGT
TTTCTCCTTCTCCACCACCTTCGTTTTCAGCATCCGCTCCGAGTTCCAGA
GCATTCTCAGCGGCCACGGCATCGCCTTCGTTATAGCTCCAACAAGAGGC
CTCCCCGGTGCCCGTCCCAGTCAGTACCTTGGCCTTTTCAACGAGAGCAA
TCTTGGCAACGAAACCAATCATGTTTTCGCCGTTGAACTCGACACAATCG
AGAGCCACGAGTTCTTTGACATCAATGACAATCACGTAGGCATCGATATC
AACAGTCTAAAGTCTGAGATATCATATCCAGCTGGTTACTATGGTGATCA
TTTTGTCAACTTGACTCTTATTAGCGGTCGCCCAATGCAAGTATGGGTTG
AATACGATGGCTTGGAGAAGCGAACCGATGTTACTTTAGCTCCAATCAAT
ATTCCCAAGCCAAGGTTACCGCTTTTGTCGCTGTCCCGTGATCTTTCCTC
TGTTCTTAATGACGCCATGTACGTTGGATTCTCATCCTCCACCGGCTCAG
TCTTAGTGTCTCATTATATTTTGGGTTGGAGTTTTAAGATCAACGGCCAA
GCGCAGGAGCTNCATCTCTCTCAACTTCC
back to top