FC877794

Overview
NameFC877794
Unique NameFC877794
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length804
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6007 contig Ccv1_Contig6007:1..804. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877794 vs. ExPASy Swiss-Prot
Match: FERON_ARATH (Receptor-like protein kinase FERONIA OS=Arabidopsis thaliana GN=FER PE=1 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.876e-53
Identity = 118/263 (44.87%), Postives = 159/263 (60.46%), Query Frame = -1
Query:   31 ITFTPSPDYNDSYAFINGIEIVSMPLNFYYTAAXXXXXXXXGFRFVGQANPYSILNRNALATLYRINVGGKHIEPSYDTGGMYRTWYMDDLYLTDAR---PSALPVNQSI-HLTWKRNYSAPDLVYKTARTMGQDREINEKYNLTWEFEVDSGFTYFLRFHFCEFQIEVTEEGDRVFQIFIANLTAEVQADVIAWTGANSVAVYRDYAVTIGPKPNEENIKQNLSIQLHPAPRWRTKYSEAILNGLEIFKVD-NNGNLAGPNP 804
            +TFTP    +++YAF+NGIE+ SMP  +  T              VG +   +I N  AL  +YR+NVGG  I PS DTG +YR+WY D  Y+  A    P     N +I + T    Y AP  VY TAR+MG   +IN  YNLTW F +DSGFTY +R HFCE    +T+   RVF I++ N TAE +ADVIAWT +N V  ++DY V     P E N +Q+L + LHP P  + +Y +++LNG+EIFK++ ++GNLAG NP
Sbjct:  172 MTFTPESAPSNAYAFVNGIEVTSMPDMYSSTDGT--------LTMVGSSGSVTIDNSTALENVYRLNVGGNDISPSADTG-LYRSWYDDQPYIFGAGLGIPETADPNMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINLNYNLTWIFSIDSGFTYLVRLHFCEVSSNITKINQRVFTIYLNNQTAEPEADVIAWTSSNGVPFHKDYVV----NPPEGNGQQDLWLALHPNPVNKPEYYDSLLNGVEIFKMNTSDGNLAGTNP 421          
BLAST of FC877794 vs. ExPASy Swiss-Prot
Match: ANX1_ARATH (Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.863e-47
Identity = 110/268 (41.04%), Postives = 155/268 (57.84%), Query Frame = -1
Query:   28 ITFTPSPDYNDSYAFINGIEIVSMPLNFYYTAAXXXXXXXXGFRFVGQANPYSILNRNALATLYRINVGGKHIEPSYDTGGMYRTWYMDDLYLTDARPSALPVNQSIHLTWKRNYS------APDLVYKTARTMGQDREINEKYNLTWEFEVDSGFTYFLRFHFCEFQIEVTEEGDRVFQIFIANLTAEVQ---ADVIAWTGANSVAVYRDYAVTIGPKPNEENIKQNLSIQLHPAPRWRTKYSEAILNGLEIFKVDNNGNLAGPNPE 804
            I FTPS  Y D++AFINGIE++ MP   + TAA           F  Q       N   L +++R+NVGG+ I  S D+GG+ RTWY D  Y+  A    L V       ++ NY       AP  +YKTAR+ G + +IN K NLTW F++D  FTY LR HFCEFQ+  ++   +VF I+I N TA+     AD+I WTG   + +Y+DYA+ +    +  N  + +++Q+ P+   + +Y ++ LNGLEIFK+D   NLAGPNPE
Sbjct:  163 IKFTPSDKYRDAFAFINGIEVIQMP-ELFDTAALVG--------FTDQTMDAKTAN---LQSMFRLNVGGQDIPGSQDSGGLTRTWYNDAPYIFSA---GLGVTLQASNNFRINYQNMPVSIAPADIYKTARSQGPNGDINLKSNLTWMFQIDKNFTYILRLHFCEFQL--SKINQKVFNIYINNRTAQADTTPADIIGWTGEKGIPMYKDYAIYV----DANNGGEEITLQMTPSTFGQPEYYDSSLNGLEIFKMDTMKNLAGPNPE 409          
BLAST of FC877794 vs. ExPASy Swiss-Prot
Match: Y5900_ARATH (Putative receptor-like protein kinase At5g39000 OS=Arabidopsis thaliana GN=At5g39000 PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.691e-46
Identity = 113/270 (41.85%), Postives = 149/270 (55.19%), Query Frame = -1
Query:   13 ITFTPSPDYNDSYAFINGIEIVSMPLNFYYTAAXXXXXXXXGFRFVGQANPYSILNRNALATLYRINVGGKHIEPSYDTGGMYRTWYMDDLYLTDARPSALPVNQSIHLTWKR---NYSAPDLVYKTARTMGQ--DREINEKYNLTWEFEVDSGFTYFLRFHFCEFQIEVTEEGDRVFQIFIANLTAEVQADVIAWTGANSVAVYRDYAVTIGPKPNEENIKQNLSIQLHPAPRWRTKYSEAILNGLEIFKV-DNNGNLAGPNPERRTIP 804
            +TFTPS D   S AF+NGIEIVS+P  FY                VG +  + I N  A  T+YR+NVGGK +  S    GM+R W  DD  +        P+   I + +     +Y APD VY T+R+MG     E N  +NLTW F VD+GF+Y +R HFCE   EV +EG RVF IFI N TA ++ DV   +G + + +Y DY V  G   +    + +L + LHP      KY +AILNG+EI K+ D +GNLAGPNP+    P
Sbjct:  169 LTFTPSLD---SLAFVNGIEIVSIPNRFYSKGGFDDVITN-----VGSSVDFHIENSTAFETVYRLNVGGKTVGDS----GMFRRWVSDDEIILSESSGISPIVPDIKINYTEKTPSYVAPDDVYATSRSMGNADHPEQNLNFNLTWLFTVDAGFSYLVRLHFCETLSEVNKEGQRVFSIFIENQTATLEMDVFRMSGGSWIPMYLDYTVIAG---SGSGRRHDLRLDLHPLVSINPKYYDAILNGVEILKMNDPDGNLAGPNPDPLVSP 423          
BLAST of FC877794 vs. ExPASy Swiss-Prot
Match: ANX2_ARATH (Receptor-like protein kinase ANXUR2 OS=Arabidopsis thaliana GN=ANX2 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 3.514e-46
Identity = 108/274 (39.42%), Postives = 159/274 (58.03%), Query Frame = -1
Query:    1 ITFTPSPDYNDSYAFINGIEIVSMPLNFYYTAAXXXXXXXXGFRFVGQANPYSILNRNALATLYRINVGGKHIEPSYDTGGMYRTWYMDDLYLTDARPSA-LPVNQSIHLTWKRN--YSAPDLVYKTARTMGQDREINEKYNLTWEFEVDSGFTYFLRFHFCEFQIEVTEEGDRVFQIFIANLTAEVQ---ADVIAWTGANSVAVYRDYAVTIGPKPNEENIKQNLSIQLHPAPRWRTKYSEAILNGLEIFKVDNNGNLAGPNPERRTIPPNLD 804
            I FTPS  +  ++AFINGIE++ MP   + TA+            VG ++  S      L T++R+NVGG+ I  S D+GG+ RTWY D  Y+  A     L  + +  + +++    +AP  VYKTAR+ G + +IN K NLTW F+VD+ FTY +R HFCEFQ+   +   +VF IFI N TA+     AD++ WTG   +  Y+DYA+ +    N     + +S+Q+ P+   + +Y ++ LNGLEIFK+D   NLAGPNP+   +  N D
Sbjct:  164 IIFTPSDKHPKAFAFINGIEVIPMP-ELFDTAS-----------LVGFSDQTSDTKTANLQTMFRLNVGGQDIPGSQDSGGLTRTWYNDAPYIFSAGLGVTLQASNNFRIDYQKMPVSTAPADVYKTARSQGPNGDINMKSNLTWMFQVDTNFTYIMRLHFCEFQL--AKINQKVFNIFINNRTAQGDTNPADILGWTGGKGIPTYKDYAIYV--DANTGGGGEEISLQMTPSTFGQPEYYDSQLNGLEIFKIDTMKNLAGPNPKPSPMQANED 421          
BLAST of FC877794 vs. ExPASy Swiss-Prot
Match: Y5389_ARATH (Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.957e-42
Identity = 107/271 (39.48%), Postives = 146/271 (53.87%), Query Frame = -1
Query:   10 ITFTPSPDYNDSYAFINGIEIVSMPLNFYYTAAXXXXXXXXGFRFVGQANPYSILNRNALATLYRINVGGKHIEPSYDTGGMYRTWYMDDLYLTDARPSALPVNQSIHLTWKRN---YSAPDLVYKTARTMGQ--DREINEKYNLTWEFEVDSGFTYFLRFHFCEFQIEVTEEGDRVFQIFIANLTAEVQADVIAWTGANSVAVYRDYAVTIGPKPNEENIKQNLSIQLHPAPRWRTKYSEAILNGLEIFKVDN-NGNLAGPNPERRTIPP 804
            +TFTPSP+   S AF+NGIEI+SMP  FY              R VG+   + I N  A  T+YR+NVGGK +    D+G M+R W  D+ +L      A+P    + + +      Y AP+ VY T R MG     E+N  +NLTW FEVD+GF Y +R HFCE Q EV + GDRVF IF     A  + DV   +G   + +Y D+ V +      +  + +L + L P       Y +AIL+G+EI K+ N +GNLAG NP  +  PP
Sbjct:  163 LTFTPSPN---SLAFVNGIEIISMPDRFYSKGGFDDVV-----RNVGRDVDFEIDNSTAFETVYRVNVGGKVVGDVGDSG-MFRRWLSDEGFLLGINSGAIPNITGVKINYTDKTPAYVAPEDVYTTCRLMGNKDSPELNLNFNLTWLFEVDAGFAYIVRLHFCETQPEVNKTGDRVFSIFFGYQLAMREMDVFRLSGGFRLPMYLDFKVLVDADGTSQ--RPSLRVDLTPYKEDYPTYYDAILSGVEILKLSNSDGNLAGLNPIPQLSPP 422          
BLAST of FC877794 vs. ExPASy Swiss-Prot
Match: Y5393_ARATH (Probable receptor-like protein kinase At5g39030 OS=Arabidopsis thaliana GN=At5g39030 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 9.269e-39
Identity = 101/257 (39.30%), Postives = 139/257 (54.09%), Query Frame = -1
Query:   43 ITFTPSPDYNDSYAFINGIEIVSMPLNFYYTAAXXXXXXXXGFRFVGQANPYSILNRNALATLYRINVGGKHIEPSYDTGGMYRTWYMDDLYLTDARPSALPVNQSIHLTWKRN-YSAPDLVYKTARTMG--QDREINEKYNLTWEFEVDSGFTYFLRFHFCEFQIEVTEEGDRVFQIFIANLTAEVQADVIAWTGANSVAVYRDYAVTIGPKPNEENIKQNLSIQLHPAPRWRTKYSEAILNGLEIFKVDNNGNLA 804
            +TF PS   N+S AF+NGIEIVSMP  FY                VG    + I N  A  T++R+NVGG H+    +  GM+R W  DD        S    + +I  T K   Y AP  VY T R MG  QD  +N  +NLTW F VD+GF+Y +R HF  F+  + +   RVF IF+ N  A  + DVI  +G   + +Y D+ + +G   +E   + +L + LHP  +   +Y EAILNG+EI K++N+GNLA
Sbjct:  165 LTFRPS---NNSLAFVNGIEIVSMPDRFYSKGGFDDLITN-----VGSLIDFEIDNSTASETVHRLNVGG-HMVDEVNDSGMFRRWLSDDYEFLIGGVSPYMPDVNISYTEKTPAYVAPAYVYSTCRMMGNAQDTYLNLNFNLTWLFTVDAGFSYLVRLHF--FEKYLNKANQRVFSIFLGNQMAREEMDVIRLSGGPRIPIYLDFRIYVG---SESGPRPDLRLDLHPLVKDNPEYYEAILNGVEILKLNNSGNLA 407          
BLAST of FC877794 vs. ExPASy Swiss-Prot
Match: Y5392_ARATH (Probable receptor-like protein kinase At5g39020 OS=Arabidopsis thaliana GN=At5g39020 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 6.874e-34
Identity = 97/261 (37.16%), Postives = 138/261 (52.87%), Query Frame = -1
Query:   28 ITFTPSPDYNDSYAFINGIEIVSMPLNFYYTAAXXXXXXXXGFRFVGQANPYSILNRNALATLYRINVGGKHIEPSYDTGGMYRTWYMDDLYLTDARPSALPVNQSIHLTWKRNYSAPDLVYKTARTMGQDREINEKYNLTWEF-EVDSGFTYFLRFHFCEFQIEVTEEGDRVFQIFIANLTAEVQADVIAWTGANSVAVYRDYAVTIGPKPNEENIKQNLSIQLHPAPRWRTKYSEAILNGLEIFKV-DNNGNLAGPNPE 804
            +TFTPS +     AF+NGIEIVSMP  FY              R V     + I N  A  +++R+NVGG+ +    D  GM+R W  DD +        +P  +  +      Y AP  VY T+R MG     N  +NLT  F  VD+G+ Y +R HFCE   +VT+ G RVF IF+ +  A+ + DVI  +G   + +Y D++V +G +     I+  L + L P       Y +AIL+G+EI K+ D++GNLA PNPE
Sbjct:  166 LTFTPSKNL---LAFVNGIEIVSMPDRFYSKGGFDNV-----LRNVSSDVDFQIDNSTAFESVHRLNVGGQIVN-EVDDSGMFRRWLSDDSFGNSGSIVNVPGVKINYTEKTPAYVAPYDVYATSRLMGNSS--NLMFNLTGMFLTVDAGYNYLVRLHFCETLPQVTKAGQRVFSIFVEDKMAKKETDVIRLSGGPRIPMYLDFSVYVGFESG--MIQPELRLDLVPLKDTNQTYYDAILSGVEILKLNDSDGNLARPNPE 413          
BLAST of FC877794 vs. ExPASy Swiss-Prot
Match: Y1357_ARATH (Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.752e-29
Identity = 84/246 (34.15%), Postives = 131/246 (53.25%), Query Frame = -1
Query:   43 SYAFINGIEIVSMPLNFYYTAAXXXXXXXXGFRFVGQANPYSILNRNALATLYRINVGGKHIEPSYDTGGMYRTWYMDDLYLTDARPSALPVNQSIHLTWKR---NYSAPDLVYKTARTMGQDREINEKYNLTWEFEVDSGFTYFLRFHFCEFQIEVTEEGDRVFQIFIANLTAEVQADVIAWTGANSVAVYRDYAVTIGPKPNEENIKQNLSIQLHPAPRWRTKYSEAILNGLEIFKVDNNGNLA 771
            S+ F+N IEIVS+    +  +             VG +     L    + T+YR+NVGG  + PS D   +YRTW  D  Y+     + + V  S ++T+     +  AP LVY+TAR M     + +++N++W+FEVD  F Y +R HFCE  ++  ++  R+F+I+I N TA    D+ A  G  +  +Y+DY   + P  ++ ++   L IQL P         +A+L+GLEIFK+  NGNLA
Sbjct:  187 SFGFVNAIEIVSVDDKLFKESVTK----------VGGSEVELGLGGRGIETMYRLNVGGPKLGPSKDLK-LYRTWETDLSYMV-IENAGVEVKNSSNITYALADDSPVAPLLVYETARMMSNTEVLEKRFNISWKFEVDPNFDYLVRLHFCELLVD--KQNQRIFRIYINNQTAAGNFDIFAHAGGKNKGIYQDY---LDPVSSKNDV---LWIQLGPDSSVGAS-GDALLSGLEIFKLSKNGNLA 411          
BLAST of FC877794 vs. ExPASy Swiss-Prot
Match: Y5613_ARATH (Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.459e-23
Identity = 82/252 (32.54%), Postives = 117/252 (46.43%), Query Frame = -1
Query:   40 YNDSYAFINGIEIVSMPLNFYYTAAXXXXXXXXGFRFVGQANPYSILNRNALATLYRINVGGKHIEPSYDTGGMYRTWYMDDLYLTDARPSALPVNQSIHLTWKRNYS----APDLVYKTARTMGQDREINEKYNLTWEFEVDSGFTYFLRFHFCEFQIEVTEEGDRVFQIFIANLTAEVQADVIAWTGANSVAVYRDYAVTIGPKPNEENIKQNLSIQLHPAPRWRTKYSEAILNGLEIFKVDN-NGNLAG 780
            +  S AFIN +EIVS+P      +A            V QA  +  L+  +L  L+RIN+GG  I P  D   + RTW  D  Y T    S         +T+    +    AP+ VY TA  M   +     +NL+W   VD G  YF+R HFC+  I      D +F +FI  L+A    D+ + T A   A Y D+ +      N      ++ +Q+ P P  ++    AILNGLEI K++N  G+L G
Sbjct:  172 HKGSTAFINAVEIVSVPDELVPDSASS----------VPQAPDFKGLSSFSLEILHRINIGGDLISPKIDP--LSRTWLSDKPYNTFPEGSRNVTVDPSTITYPDGGATALIAPNPVYATAEEMADAQTSQPNFNLSWRMSVDFGHDYFIRLHFCD--IVSKSLNDLIFNVFINKLSAISALDLSSLTSALGTAYYADFVLNASTITN-----GSILVQVGPTPNLQSGKPNAILNGLEIMKLNNAAGSLDG 404          
BLAST of FC877794 vs. ExPASy Swiss-Prot
Match: HERK_ARATH (Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana GN=HERK1 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.074e-22
Identity = 75/254 (29.53%), Postives = 123/254 (48.43%), Query Frame = -1
Query:   55 ITFTPSPDYNDSYAFINGIEIVSMPLNFYYTAAXXXXXXXXGFRFVGQANPYSILNRNALATLYRINVGGKHIEPSYDTGGMYRTWYMDDLYLTDARPSALPVNQSIHLTWKRNY----SAPDLVYKTARTMGQDREINEKYNLTWEFEVDSGFTYFLRFHFCEFQIEVTEEGDRVFQIFIANLTAEVQADVIAWTGANSVAVYRDYAVTIGPKPNEENIKQNLSIQLHPAPRWRTKYSEAILNGLEIFKVDNN 804
            +TFTPS   + S+AF+N IE++S+P      +           RFVG    +  ++   L T++R+N+GG  +  + DT  + RTW  D  +L + +  A  +++   + +   Y    SAP  VY +   M      N  +N+TWEF+VD GF Y+ RFHFC+  I         F +++ ++ A    D+           Y    VT  PK + +     + + + P+    T Y  AI+NGLEI K++N+
Sbjct:  154 LTFTPS---SGSFAFVNAIEVISIPDTLITGSP----------RFVGNPAQFPDMSMQGLETIHRVNMGGPLVASNNDT--LTRTWVPDSEFLLE-KNLAKSMSKFSTVNFVPGYATEDSAPRTVYGSCTEMNSADNPNSIFNVTWEFDVDPGFQYYFRFHFCD--IVSLSLNQLYFNLYVDSMVAATDIDLSTLVDNTLAGAYSMDFVTQTPKGSNK-----VRVSIGPS-TVHTDYPNAIVNGLEIMKMNNS 383          
The following BLAST results are available for this feature:
BLAST of FC877794 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
FERON_ARATH3.876e-5344.87Receptor-like protein kinase FERONIA OS=Arabidopsi... [more]
ANX1_ARATH1.863e-4741.04Receptor-like protein kinase ANXUR1 OS=Arabidopsis... [more]
Y5900_ARATH2.691e-4641.85Putative receptor-like protein kinase At5g39000 OS... [more]
ANX2_ARATH3.514e-4639.42Receptor-like protein kinase ANXUR2 OS=Arabidopsis... [more]
Y5389_ARATH8.957e-4239.48Probable receptor-like protein kinase At5g38990 OS... [more]
Y5393_ARATH9.269e-3939.30Probable receptor-like protein kinase At5g39030 OS... [more]
Y5392_ARATH6.874e-3437.16Probable receptor-like protein kinase At5g39020 OS... [more]
Y1357_ARATH1.752e-2934.15Probable receptor-like protein kinase At1g30570 OS... [more]
Y5613_ARATH5.459e-2332.54Probable receptor-like protein kinase At5g61350 OS... [more]
HERK_ARATH2.074e-2229.53Receptor-like protein kinase HERK 1 OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA58BG03RM1 IVIA1 Citrus clementina cDNA clone IC0AAA58BG03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877794 ID=FC877794|Name=FC877794|organism=Citrus clementina|type=EST|length=804bp
ATCTAAATTAGGTGGGATCGTCCGACGTTCAGGATTAGGTCCGGCGAGAT
TCCCATTGTTGTCCACTTTAAAGATTTCAAGGCCGTTCAAGATAGCTTCA
GAGTATTTGGTCCTCCATCTGGGGGCAGGGTGCAGTTGAATAGAAAGATT
CTGCTTAATATTTTCTTCATTTGGTTTTGGTCCTATCGTCACAGCATAAT
CTCTATATACGGCAACACTATTCGCACCAGTCCAGGCTATCACATCTGCT
TGAACTTCAGCAGTTAAATTAGCAATGAAGATCTGGAACACCCTATCGCC
CTCTTCAGTTACCTCTATCTGAAACTCACAAAAATGAAACCTCAGAAAAT
ATGTAAAGCCAGAATCCACTTCGAACTCCCAAGTGAGATTATACTTCTCG
TTGATTTCCCTGTCCTGCCCCATCGTCCTGGCGGTTTTGTAGACCAGATC
TGGAGCAGAGTAATTACGTTTCCAAGTGAGATGAATACTCTGGTTAACGG
GAAGAGCACTTGGTCTGGCATCTGTCAAGTAGAGGTCGTCCATATACCAA
GTTCGGTACATGCCGCCGGTGTCGTATGACGGTTCGATATGTTTCCCGCC
GACGTTTATCCTGTATAAAGTCGCCAGAGCATTTCTGTTTAAGATACTGT
ATGGGTTGGCCTGGCCAACAAACCTGAACCCCCCGCCGGGATCGCCGGGA
TCATCGGCCGCGGTGTAATAGAAATTGAGGGGCATGGATACAATCTCAAT
TCCATTGATAAAAGCATATGAATCGTTGTAATCCGGACTTGGAGTGAAAG
TTAT
back to top