FC877799

Overview
NameFC877799
Unique NameFC877799
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length857
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig403 contig Ccv1_Contig403:50..906. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877799 vs. ExPASy Swiss-Prot
Match: HSP70_SOYBN (Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 2.448e-125
Identity = 226/285 (79.30%), Postives = 241/285 (84.56%), Query Frame = 2
Query:    2 TSQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXGIETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEEIERMVQXXXXXXXXXXXXXXXXXXXNSLENYAYNMRNTVRDEKIAGK 856
            T+QTTIEIDSLYEGIDFYATITRARFEE+NMDLFRKCMEPVEKCLRD+KIDKSQVH+VVLVGGSTRIPKV QLLQDFFNGKELCKSINPDE           ILSG+G+EKVQD           G+ETAGGVMT LIPRNTTIPTKKEQIFSTYSDNQPGVLIQV+EGERARTKDNNLLGKFELTGIPPAPRGVPQ+NVCFDIDANGIL+VSAEDKTAGVKN+ITITNDKGRLSKEEIE+MV+                   NSLENYAYNMRNT++DEKI GK
Sbjct:  282 TAQTTIEIDSLYEGIDFYATITRARFEEMNMDLFRKCMEPVEKCLRDAKIDKSQVHEVVLVGGSTRIPKVHQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGQGDEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELTGIPPAPRGVPQVNVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIEKMVKDAERYKAEDEEVKKKVEAKNSLENYAYNMRNTIKDEKIGGK 566          
BLAST of FC877799 vs. ExPASy Swiss-Prot
Match: HSP71_ARATH (Heat shock cognate 70 kDa protein 1 OS=Arabidopsis thaliana GN=HSC70-1 PE=1 SV=3)

HSP 1 Score: 442.58 bits (1137), Expect = 1.343e-123
Identity = 224/285 (78.60%), Postives = 238/285 (83.51%), Query Frame = 2
Query:    2 TSQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXGIETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEEIERMVQXXXXXXXXXXXXXXXXXXXNSLENYAYNMRNTVRDEKIAGK 856
            T+QTTIEIDSLYEGIDFY+TITRARFEELNMDLFRKCMEPVEKCLRD+K+DKS VHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNEKVQD           G+ETAGGVMTTLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGERARTKDNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGIL+VSAEDKT G KN+ITITNDKGRLSK+EIE+MVQ                   N+LENYAYNMRNT++DEKI  K
Sbjct:  283 TAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEK 567          
BLAST of FC877799 vs. ExPASy Swiss-Prot
Match: HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 8.706e-123
Identity = 222/285 (77.89%), Postives = 236/285 (82.81%), Query Frame = 2
Query:    2 TSQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXGIETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEEIERMVQXXXXXXXXXXXXXXXXXXXNSLENYAYNMRNTVRDEKIAGK 856
            T+QTTIEIDSLYEGIDFY+TITRARFEELNMDLFRKCMEPVEKCLRD+K+DKS VHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNEKVQD           G+ETAGGVMT LIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFEL+GIPPAPRGVPQI VCFDIDANG L+VSAEDKT G KN+ITITNDKGRLSKEEIE+MVQ                   N+LENYAYNMRNT++DEKIA K
Sbjct:  283 TAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGTLNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASK 567          
BLAST of FC877799 vs. ExPASy Swiss-Prot
Match: HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 1.940e-122
Identity = 222/282 (78.72%), Postives = 235/282 (83.33%), Query Frame = 2
Query:    2 TSQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXGIETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEEIERMVQXXXXXXXXXXXXXXXXXXXNSLENYAYNMRNTVRDEKI 847
            T+QTTIEIDSLYEGIDFY+TITRARFEELNMDLFRKCMEPVEKCLRD+K+DKS VHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNEKVQD           G+ETAGG MT LIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGERARTKDNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGIL+VSAEDKT G KN+ITITNDKGRLSKEEIERMVQ                   N+LENYAYNMRNT++D+KI
Sbjct:  283 TAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGGMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKKKVEAKNALENYAYNMRNTIKDDKI 564          
BLAST of FC877799 vs. ExPASy Swiss-Prot
Match: HSP7E_SPIOL (Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3)

HSP 1 Score: 432.565 bits (1111), Expect = 1.390e-120
Identity = 218/285 (76.49%), Postives = 233/285 (81.75%), Query Frame = 2
Query:    2 TSQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXGIETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEEIERMVQXXXXXXXXXXXXXXXXXXXNSLENYAYNMRNTVRDEKIAGK 856
            T+QTTIEIDSLYEG+DFY+ ITRARFEELN+DLFRKCMEPVEKCLRD+K+DKS VHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNEKVQD           G+ETAGGVMT LIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFEL+GIPP PRGVPQINVCFDIDANGIL+VSAEDKT G KN+I ITNDKGRLSKEEIE+MVQ                   N+LENYAYNMRN V+DEKI  K
Sbjct:  283 TAQTTIEIDSLYEGVDFYSPITRARFEELNIDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPGPRGVPQINVCFDIDANGILNVSAEDKTTGQKNKIRITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNIVKDEKIGAK 567          
BLAST of FC877799 vs. ExPASy Swiss-Prot
Match: HSP72_ARATH (Heat shock cognate 70 kDa protein 2 OS=Arabidopsis thaliana GN=HSC70-2 PE=2 SV=2)

HSP 1 Score: 429.869 bits (1104), Expect = 9.010e-120
Identity = 217/285 (76.14%), Postives = 234/285 (82.11%), Query Frame = 2
Query:    2 TSQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXGIETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEEIERMVQXXXXXXXXXXXXXXXXXXXNSLENYAYNMRNTVRDEKIAGK 856
            T+QTTIEIDSLY G DFY+ ITRARFEE+NMDLFRKCMEPVEKCLRD+K+DKS VH++VLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNEKVQD           G+ETAGGVMTTLI RNTTIPTKKEQ+FSTYSDNQPGVLIQV+EGERARTKDNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGIL+VSAEDKT G KN+ITITNDKGRLSKE+IE+MVQ                   N+LENYAYNMRNT+RDEKI  K
Sbjct:  283 TAQTTIEIDSLYGGADFYSPITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHEIVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGKKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGEK 567          
BLAST of FC877799 vs. ExPASy Swiss-Prot
Match: HSP73_ARATH (Heat shock cognate 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSC70-3 PE=1 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 9.961e-119
Identity = 216/285 (75.79%), Postives = 233/285 (81.75%), Query Frame = 2
Query:    2 TSQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXGIETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEEIERMVQXXXXXXXXXXXXXXXXXXXNSLENYAYNMRNTVRDEKIAGK 856
            T+QTTIEIDSL++GIDFYA ITRARFEELN+DLFRKCMEPVEKCLRD+K+DK+ + DVVLVGGSTRIPKVQQLL DFFNGKELCKSINPDE           ILSGEGNEKVQD           G+ETAGGVMT LI RNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGERARTKDNNLLGKFEL+GIPPAPRGVPQI VCFDIDANGIL+VSAEDKT G KN+ITITNDKGRLSK+EIE+MVQ                   N+LENYAYNMRNT+RDEKI  K
Sbjct:  283 TAQTTIEIDSLFDGIDFYAPITRARFEELNIDLFRKCMEPVEKCLRDAKMDKNSIDDVVLVGGSTRIPKVQQLLVDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEK 567          
BLAST of FC877799 vs. ExPASy Swiss-Prot
Match: HSP70_DAUCA (Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 7.139e-117
Identity = 216/289 (74.74%), Postives = 235/289 (81.31%), Query Frame = 2
Query:    2 TSQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXGIETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDN----NLLGKFELTGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEEIERMVQXXXXXXXXXXXXXXXXXXXNSLENYAYNMRNTVRDEKIAGK 856
            T+QTTIEIDSLYEG+DFY TITRARFEELNMDLF+KCM+PVEKCLRDSKIDK+QVH+VVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNE+  D           G+ETAGGVMT LIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERART+DN     LLGKFELTGIPPAPRGVPQINV FDIDANGIL+V AEDKTAGVKN+ITITND GRLSK+EIE++V+                   N+LENYAYNMRNT++D+KI GK
Sbjct:  282 TAQTTIEIDSLYEGVDFYTTITRARFEELNMDLFKKCMDPVEKCLRDSKIDKAQVHEVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNER-SDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTRDNKLLGKLLGKFELTGIPPAPRGVPQINVVFDIDANGILNVFAEDKTAGVKNKITITNDNGRLSKDEIEKLVKEAEKYKAEDEEVKKKVEAKNALENYAYNMRNTIKDDKIPGK 569          
BLAST of FC877799 vs. ExPASy Swiss-Prot
Match: HSP71_SOLLC (Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 1.590e-116
Identity = 217/287 (75.61%), Postives = 234/287 (81.53%), Query Frame = 2
Query:    2 TSQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQL-LQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXGIETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGE-RARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEEIERMVQXXXXXXXXXXXXXXXXXXXNSLENYAYNMRNTVRDEKIAGK 856
            T+QTTIEIDSLYEG+DFY+TITRARFEELNMDLFRKCMEPVEKCLRD+K+DKS VHDVVLVGGSTRIPKVQQ+ + +FFNGKELCKSINPDE           ILSGEGNEKVQD           G+ETAGGVMT LIPRNTTIPTKKEQ+FSTYSDNQPGVLIQV+EGE RART+DNNLLGKFEL+ IPPAPR VPQI VCFDIDANGIL+VSAEDKT G KN+ITITNDKGRLSKEEIE+MVQ                   NSLENYAYNMRNTV+DEKI  K
Sbjct:  283 TAQTTIEIDSLYEGVDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQVAMTNFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERRARTRDNNLLGKFELSVIPPAPRVVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEELKKKVEAKNSLENYAYNMRNTVKDEKIGSK 569          
BLAST of FC877799 vs. ExPASy Swiss-Prot
Match: HSP70_CHLRE (Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2)

HSP 1 Score: 410.994 bits (1055), Expect = 4.331e-114
Identity = 211/284 (74.30%), Postives = 230/284 (80.99%), Query Frame = 2
Query:    5 SQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXGIETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEEIERMVQXXXXXXXXXXXXXXXXXXXNSLENYAYNMRNTVRDEKIAGK 856
            +QTTIE+DSL+EG+DF  +ITRARFEEL MDLFRKCM+PVEKCL D+K+DK  VHDVVLVGGSTRIPKVQQLLQDFFNGKEL KSINPDE           IL+GEG EKVQD           G+ETAGGVMT LIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINV FDIDANGIL+VSAEDKT G KN+ITITNDKGRLSK+EIERMVQ                   NSLENYAYNMRNT+R++K+A +
Sbjct:  284 AQTTIELDSLFEGVDFATSITRARFEELCMDLFRKCMDPVEKCLHDAKMDKMTVHDVVLVGGSTRIPKVQQLLQDFFNGKELNKSINPDEAVAYGAAVQAAILTGEGGEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVIFDIDANGILNVSAEDKTTGNKNKITITNDKGRLSKDEIERMVQ-EAEKYKADDEQLKKVEAKNSLENYAYNMRNTIREDKVASQ 566          
The following BLAST results are available for this feature:
BLAST of FC877799 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP70_SOYBN2.448e-12579.30Heat shock 70 kDa protein OS=Glycine max GN=HSP70 ... [more]
HSP71_ARATH1.343e-12378.60Heat shock cognate 70 kDa protein 1 OS=Arabidopsis... [more]
HSP72_SOLLC8.706e-12377.89Heat shock cognate 70 kDa protein 2 OS=Solanum lyc... [more]
HSP7C_PETHY1.940e-12278.72Heat shock cognate 70 kDa protein OS=Petunia hybri... [more]
HSP7E_SPIOL1.390e-12076.49Chloroplast envelope membrane 70 kDa heat shock-re... [more]
HSP72_ARATH9.010e-12076.14Heat shock cognate 70 kDa protein 2 OS=Arabidopsis... [more]
HSP73_ARATH9.961e-11975.79Heat shock cognate 70 kDa protein 3 OS=Arabidopsis... [more]
HSP70_DAUCA7.139e-11774.74Heat shock 70 kDa protein OS=Daucus carota GN=HSP7... [more]
HSP71_SOLLC1.590e-11675.61Heat shock cognate 70 kDa protein 1 OS=Solanum lyc... [more]
HSP70_CHLRE4.331e-11474.30Heat shock 70 kDa protein OS=Chlamydomonas reinhar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA12AG05RM1 IVIA1 Citrus clementina cDNA clone IC0AAA12AG05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877799 ID=FC877799|Name=FC877799|organism=Citrus clementina|type=EST|length=857bp
TACATCACAGACGACAATTGAGATTGATTCGCTCTATGAAGGCATTGACT
TCTATGCGACAATTACTAGGGCTAGGTTTGAAGAATTGAACATGGATTTG
TTCAGAAAATGTATGGAACCTGTGGAGAAATGTCTTCGCGACTCAAAAAT
TGATAAGAGCCAGGTTCATGATGTTGTTCTTGTTGGTGGCTCAACAAGAA
TTCCAAAAGTTCAACAATTGTTGCAAGACTTCTTTAACGGGAAGGAACTG
TGCAAGAGCATAAACCCTGATGAGGCTGTAGCTTATGGAGCTGCTGTGCA
GGCTGCTATTTTGAGCGGTGAAGGGAATGAGAAGGTTCAAGATTTGCTGC
TGCTTGATGTTACTCCTCTGAGCCTCGGTATTGAGACTGCTGGCGGTGTA
ATGACAACCTTGATTCCAAGGAACACGACAATTCCTACAAAGAAAGAGCA
AATTTTCTCAACTTATTCAGACAATCAGCCTGGTGTGTTGATTCAGGTGT
ATGAAGGTGAAAGGGCTAGAACAAAAGATAACAATCTGCTTGGGAAATTC
GAGCTCACGGGCATTCCTCCGGCACCAAGAGGTGTTCCTCAGATCAATGT
GTGCTTTGACATTGATGCTAATGGTATATTGCATGTCTCAGCAGAAGATA
AGACTGCTGGAGTGAAGAACCAGATTACAATCACCAACGATAAGGGAAGA
TTGAGCAAGGAGGAAATTGAGAGAATGGTGCAAGAGGCAGAGAAGTACAA
GGCAGAGGATGAAGAGGTAAAGAAGAAAGTAGAGGCCAAGAACTCATTGG
AGAATTATGCTTATAACATGAGGAACACTGTGAGAGATGAGAAGATTGCG
GGAAAAC
back to top