FC877802

Overview
NameFC877802
Unique NameFC877802
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length887
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10461 contig Ccv1_Contig10461:1..887. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877802 vs. ExPASy Swiss-Prot
Match: CLCC_ARATH (Chloride channel protein CLC-c OS=Arabidopsis thaliana GN=CLC-C PE=1 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.302e-84
Identity = 167/261 (63.98%), Postives = 185/261 (70.88%), Query Frame = 3
Query:  111 MDHGSRGDREENDIEVEGGGHNGSFESERRKFVERMGSGTSEDHNL--REPLLLKCRTNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGFVANTSXXXXXXXXXXXXXXXXXXXXXGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYHLTWRWLRYFKNDRDR 887
            MD    GD   +DIEVEGG  +G          ER  SG  +D ++  R+PLL + R NTTSQIAIVGAN CPIESLDYEI EN+ FKQDWR+R+K+EI QY   KW LA LIG+ TGL     N  VENIAGFKLLLI NLML +++F  F A                        GSGIPEVKAYLNGIDA+SILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKY LTW+WLR+FKNDRDR
Sbjct:    1 MDDRHEGDH--HDIEVEGGALHG---------FERKISGILDDGSVGFRQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDFFKQDWRSRKKIEILQYTFLKWALAFLIGLATGLVGFLNNLGVENIAGFKLLLIGNLMLKEKYFQAFFAFAGCNLILATAAASLCAFIAPAAAGSGIPEVKAYLNGIDAYSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYRLTWKWLRFFKNDRDR 250          
BLAST of FC877802 vs. ExPASy Swiss-Prot
Match: CLCG_ARATH (Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=At5g33280 PE=2 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.954e-64
Identity = 124/226 (54.87%), Postives = 154/226 (68.14%), Query Frame = 3
Query:  216 MGSGTSEDHNLREPLL--LKCRTNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGFVANTSXXXXXXXXXXXXXXXXXXXXXGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYHLTWRWLRYFKNDRDR 887
            M + T+ED ++  PLL  L+  TN+TSQ+AIVGAN+CPIESLDYEI EN+ FKQDWR R KVEIFQYV  KW L   IG++  L     N  VEN+AG K ++ +N+M+  R  MGFV  +                      GSGIPEVKAYLNG+DA  I +  TL +KI G+I  V+A  ++GK GPMVHTGAC+A++LGQGGSK+Y LTWRWLR+FKNDRDR
Sbjct:    1 MPNSTTED-SVAVPLLPSLRRATNSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYVFMKWLLCFCIGIIVSLIGFANNLAVENLAGVKFVVTSNMMIAGRFAMGFVVFSVTNLILTLFASVITAFVAPAAAGSGIPEVKAYLNGVDAPEIFSLRTLIIKIIGNISAVSASLLIGKAGPMVHTGACVASILGQGGSKRYRLTWRWLRFFKNDRDR 225          
BLAST of FC877802 vs. ExPASy Swiss-Prot
Match: CLCA_ARATH (Chloride channel protein CLC-a OS=Arabidopsis thaliana GN=CLC-A PE=1 SV=2)

HSP 1 Score: 229.95 bits (585), Expect = 1.449e-59
Identity = 115/250 (46.00%), Postives = 154/250 (61.60%), Query Frame = 3
Query:  138 EENDIEVEGGGHNGSFESERRKFVERMGSGTSEDHNLREPLLLKCRTNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGFVANTSXXXXXXXXXXXXXXXXXXXXXGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYHLTWRWLRYFKNDRDR 887
            E+ ++++    +NG  E E             E++ L +PLL + RT +++ +A+VGA +  IESLDYEI EN+LFK DWR+R K ++FQY+  KWTLA L+G+ TGL A   N  VENIAG+KLL +   +  DR + G +  T                      G GIPE+KAYLNGID  ++   +T+ VKI GSI  VAAG  +GKEGP+VH G+CIA+LLGQGG   + + WRWLRYF NDRDR
Sbjct:    3 EDGNLQISNSNYNGEEEGE-----------DPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKAQVFQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTGANLGLTLVATVLVVYFAPTAAGPGIPEIKAYLNGIDTPNMFGFTTMMVKIVGSIGAVAAGLDLGKEGPLVHIGSCIASLLGQGGPDNHRIKWRWLRYFNNDRDR 241          
BLAST of FC877802 vs. ExPASy Swiss-Prot
Match: CLCB_ARATH (Chloride channel protein CLC-b OS=Arabidopsis thaliana GN=CLC-B PE=1 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.772e-57
Identity = 113/249 (45.38%), Postives = 149/249 (59.84%), Query Frame = 3
Query:  141 ENDIEVEGGGHNGSFESERRKFVERMGSGTSEDHNLREPLLLKCRTNTTSQIAIVGANICPIESLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGFVANTSXXXXXXXXXXXXXXXXXXXXXGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYHLTWRWLRYFKNDRDR 887
            E D+   GG  N + E            G  E + L +PL+   RT +++ +A+VGA +  IESLDYEI EN+LFK DWR R K ++ QYV  KWTLA L+G+ TGL A   N  VENIAG+KLL + + +  +R+  G +                         G GIPE+KAYLNG+D  ++   +T+ VKI GSI  VAAG  +GKEGP+VH G+CIA+LLGQGG+  + + WRWLRYF NDRDR
Sbjct:    3 EEDLNQIGGNSNYNGEG-----------GDPESNTLNQPLVKANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKAQVLQYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLTQERYVTGLMVLVGANLGLTLVASVLCVCFAPTAAGPGIPEIKAYLNGVDTPNMFGATTMIVKIVGSIGAVAAGLDLGKEGPLVHIGSCIASLLGQGGTDNHRIKWRWLRYFNNDRDR 240          
BLAST of FC877802 vs. ExPASy Swiss-Prot
Match: CLCD_ARATH (Chloride channel protein CLC-d OS=Arabidopsis thaliana GN=CLC-D PE=1 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 4.684e-42
Identity = 91/188 (48.40%), Postives = 113/188 (60.11%), Query Frame = 3
Query:  324 IESLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGFVANTSXXXXXXXXXXXXXXXXXXXXXGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYHLTWRWLRYFKNDRDR 887
            + SLDYE++EN  ++++   R K+ +  YV  KW  +LLIG+ TGLAAVF N  VEN AG+K  L    ++   +F GF+                         GSGIPE+K YLNGID    L   TL  KIFGSI  V  G  +GKEGP+VHTGACIA+LLGQGGS KYHL  RW + FK+DRDR
Sbjct:   44 VNSLDYEVIENYAYREEQAHRGKLYVGYYVAVKWFFSLLIGIGTGLAAVFINLSVENFAGWKFAL-TFAIIQKSYFAGFIVYLLINLVLVFSSAYIITQFAPAAAGSGIPEIKGYLNGIDIPGTLLFRTLIGKIFGSIGSVGGGLALGKEGPLVHTGACIASLLGQGGSTKYHLNSRWPQLFKSDRDR 230          
BLAST of FC877802 vs. ExPASy Swiss-Prot
Match: CLCN7_RAT (H(+)/Cl(-) exchange transporter 7 OS=Rattus norvegicus GN=Clcn7 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.850e-22
Identity = 61/191 (31.94%), Postives = 96/191 (50.26%), Query Frame = 3
Query:  327 ESLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLM--LNDRHFMGF--VANTSXXXXXXXXXXXXXXXXXXXXXGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYHLTWRWLRYFKNDRDR 887
            ESLDY+  EN+LF ++ R           + +W +  LIG+LTGL A F +  VEN+AG K  +I + +    ++  + F  +   +                     GSGIP++K +LNG+    ++   TL +K+ G I  V  G  VGKEGPM+H+G+ IA  + QG S      ++   YF+ D ++
Sbjct:   93 ESLDYDNSENQLFLEEERRINHTAFRTVEIKRWVICALIGILTGLVACFIDIVVENLAGLKYRVIKDNIDKFTEKGGLSFSLLLWATLNSAFVLVGSVIVAFIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFEYFRRDTEK 283          
BLAST of FC877802 vs. ExPASy Swiss-Prot
Match: CLCN7_MOUSE (H(+)/Cl(-) exchange transporter 7 OS=Mus musculus GN=Clcn7 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.850e-22
Identity = 61/191 (31.94%), Postives = 96/191 (50.26%), Query Frame = 3
Query:  327 ESLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLM--LNDRHFMGF--VANTSXXXXXXXXXXXXXXXXXXXXXGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYHLTWRWLRYFKNDRDR 887
            ESLDY+  EN+LF ++ R           + +W +  LIG+LTGL A F +  VEN+AG K  +I + +    ++  + F  +   +                     GSGIP++K +LNG+    ++   TL +K+ G I  V  G  VGKEGPM+H+G+ IA  + QG S      ++   YF+ D ++
Sbjct:   93 ESLDYDNSENQLFLEEERRINHTAFRTVEIKRWVICALIGILTGLVACFIDIVVENLAGLKYRVIKDNIDKFTEKGGLSFSLLLWATLNSAFVLVGSVIVAFIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFEYFRRDTEK 283          
BLAST of FC877802 vs. ExPASy Swiss-Prot
Match: CLCN7_HUMAN (H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens GN=CLCN7 PE=1 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 2.417e-22
Identity = 61/191 (31.94%), Postives = 95/191 (49.74%), Query Frame = 3
Query:  327 ESLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLM--LNDRHFMGF--VANTSXXXXXXXXXXXXXXXXXXXXXGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYHLTWRWLRYFKNDRDR 887
            ESLDY+  EN+LF ++ R           + +W +  LIG+LTGL A F +  VEN+AG K  +I   +    ++  + F  +   +                     GSGIP++K +LNG+    ++   TL +K+ G I  V  G  VGKEGPM+H+G+ IA  + QG S      ++   YF+ D ++
Sbjct:   95 ESLDYDNSENQLFLEEERRINHTAFRTVEIKRWVICALIGILTGLVACFIDIVVENLAGLKYRVIKGNIDKFTEKGGLSFSLLLWATLNAAFVLVGSVIVAFIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFEYFRRDTEK 285          
BLAST of FC877802 vs. ExPASy Swiss-Prot
Match: CLCN7_BOVIN (H(+)/Cl(-) exchange transporter 7 OS=Bos taurus GN=CLCN7 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.199e-21
Identity = 59/191 (30.89%), Postives = 93/191 (48.69%), Query Frame = 3
Query:  327 ESLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLI-NNLMLNDRH---FMGFVANTSXXXXXXXXXXXXXXXXXXXXXGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYHLTWRWLRYFKNDRDR 887
            ESLDY+  EN+LF ++ R           + +W +  ++G+LTGL A F +  VE +AG K  L+ +N+     H       +   +                     GSGIP++K +LNG+    ++   TL +K+ G I  V  G  VGKEGPM+H+G+ IA  + QG S      ++   YF+ D ++
Sbjct:   99 ESLDYDNSENQLFLEEERRINHTAFRTVEIKRWVICAMVGILTGLVACFIDIVVEKLAGLKYRLVKDNIDRFTEHGGLSFSLLLWAALNAAFVLLGSTIVAFIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFEYFRRDTEK 289          
BLAST of FC877802 vs. ExPASy Swiss-Prot
Match: CLCA_DICDI (Chloride channel protein A OS=Dictyostelium discoideum GN=clcA PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.732e-20
Identity = 59/187 (31.55%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  327 ESLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFKLLLINNLMLNDRHFMGFVANTSXXXXXXXXXXXXXXXXXXXXXGSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSKKYHLTWRWLRYFKNDRDR 887
            ESLD+ I++N+++++  R   K+        KW +  +IGVL G+ A      VE +  FK       + ++R F+ F+   S                     GSGIPEVK YLNGI     +   TL  K+   I   ++G ++G EGPM+H G+ +   +GQ  SK      + L  + NDRDR
Sbjct:   96 ESLDFPIIDNQIYREYIRRTSKLNHMLKTFGKWIICFMIGVLVGITAYLVKQSVEFVNEFKFDQSGKYLEDERKFIAFLVYYSINILFGVSASLVIIPVGQIASGSGIPEVKGYLNGIRIPQSMNVKTLVGKLVSLILAYSSGLILGPEGPMIHIGSMLGGAIGQVKSKTLKWYPKVLWKYHNDRDR 282          
The following BLAST results are available for this feature:
BLAST of FC877802 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
CLCC_ARATH1.302e-8463.98Chloride channel protein CLC-c OS=Arabidopsis thal... [more]
CLCG_ARATH1.954e-6454.87Putative chloride channel-like protein CLC-g OS=Ar... [more]
CLCA_ARATH1.449e-5946.00Chloride channel protein CLC-a OS=Arabidopsis thal... [more]
CLCB_ARATH1.772e-5745.38Chloride channel protein CLC-b OS=Arabidopsis thal... [more]
CLCD_ARATH4.684e-4248.40Chloride channel protein CLC-d OS=Arabidopsis thal... [more]
CLCN7_RAT1.850e-2231.94H(+)/Cl(-) exchange transporter 7 OS=Rattus norveg... [more]
CLCN7_MOUSE1.850e-2231.94H(+)/Cl(-) exchange transporter 7 OS=Mus musculus ... [more]
CLCN7_HUMAN2.417e-2231.94H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens ... [more]
CLCN7_BOVIN1.199e-2130.89H(+)/Cl(-) exchange transporter 7 OS=Bos taurus GN... [more]
CLCA_DICDI1.732e-2031.55Chloride channel protein A OS=Dictyostelium discoi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA24CC08RM1 IVIA1 Citrus clementina cDNA clone IC0AAA24CC08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877802 ID=FC877802|Name=FC877802|organism=Citrus clementina|type=EST|length=887bp
AAAAAACTTATTTCTGTTTTTGTTATTCATTGATAAAAAAAGAGATTTTC
TTTTTTATTCTTTTGGGTGTGGAATCAAAAAAGATTTGTGGGTTTGAAGA
TTGAAGGAAAATGGATCATGGAAGTAGAGGAGATAGGGAGGAGAATGATA
TAGAGGTTGAAGGAGGAGGGCATAATGGTAGTTTTGAAAGTGAAAGGAGG
AAGTTTGTTGAGAGAATGGGATCAGGAACGTCAGAGGATCATAATTTGAG
AGAGCCATTGTTGTTGAAGTGTAGGACCAATACAACTTCTCAGATTGCCA
TTGTTGGTGCCAATATCTGCCCGATTGAGTCTCTTGATTATGAGATTGTC
GAGAATGAGCTTTTTAAGCAGGACTGGAGAGCAAGACGGAAGGTTGAGAT
ATTTCAGTACGTTGTCTTCAAGTGGACACTTGCACTCCTTATTGGGGTGC
TTACAGGGCTTGCAGCCGTTTTCTGTAACTTTTTTGTTGAGAATATAGCT
GGTTTTAAACTTCTGCTTATCAACAATCTCATGCTTAATGATAGGCACTT
TATGGGATTTGTAGCAAATACGAGTATCAACCTGGGTTTGGCCATTTTAG
CTGCAATCCTTTGTGCTTATATTGCCCCTGCAGCTGCCGGCTCTGGTATA
CCCGAGGTGAAAGCATATCTCAATGGTATAGATGCCCATTCTATATTGGC
TCCAAGTACCCTCTTTGTTAAGATTTTTGGTTCCATTTTTGGAGTTGCTG
CTGGATTTGTTGTCGGTAAGGAAGGACCTATGGTACATACTGGTGCTTGC
ATAGCCAATTTACTTGGACAAGGCGGATCGAAGAAGTACCATTTGACCTG
GAGATGGCTCAGATACTTCAAAAATGATCGTGACCGG
back to top