FC877881

Overview
NameFC877881
Unique NameFC877881
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length880
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6308 contig Ccv1_Contig6308:148..1027. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877881 vs. ExPASy Swiss-Prot
Match: NIPA3_PONAB (Magnesium transporter NIPA3 OS=Pongo abelii GN=NIPAL1 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 4.948e-44
Identity = 92/190 (48.42%), Postives = 125/190 (65.79%), Query Frame = 2
Query:  314 IGFILAVVSSAFIGSSFIIXXXXXXXXXXXXXXXXXXXXXXXL-EPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGI 880
            +G +LAV SS FIGSSFI+                       L E LWWVG+ +M VGE ANF AY +APA LVTPLGALS+++SA+L+ + LNE L   G +GC+L ++GST++V+HAP EE + S+ E+ +    P F+ +   V  ++LVLIL  AP+ GQTNIL+YI ICS+IG+ +V SVK +GI
Sbjct:   70 VGLVLAVSSSIFIGSSFILKKKGLLQLASKGITRAGQGGHSYLKEWLWWVGLLSMGVGEAANFAAYAFAPATLVTPLGALSVLISAILSSYFLNEHLNIHGKIGCILSILGSTVMVIHAPQEEEVTSLHEMEMKLRDPGFISFAVIVTVISLVLILIVAPKKGQTNILVYISICSLIGAFSVSSVKGLGI 259          
BLAST of FC877881 vs. ExPASy Swiss-Prot
Match: NIPA3_HUMAN (Magnesium transporter NIPA3 OS=Homo sapiens GN=NIPAL1 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.880e-43
Identity = 90/190 (47.37%), Postives = 124/190 (65.26%), Query Frame = 2
Query:  314 IGFILAVVSSAFIGSSFIIXXXXXXXXXXXXXXXXXXXXXXXL-EPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGI 880
            +G +LAV SS FIGSSFI+                       L E LWWVG+ +M  GE ANF AY +APA LVTPLGALS+++SA+L+ + LNE L   G +GC+L ++GST++V+HAP EE + S+ E+ +    P F+ +   +  ++LVLIL  AP+ GQTNIL+YI ICS+IG+ +V SVK +GI
Sbjct:   70 VGLVLAVSSSIFIGSSFILKKKGLLQLASKGFTRAGQGGHSYLKEWLWWVGLLSMGAGEAANFAAYAFAPATLVTPLGALSVLISAILSSYFLNEHLNIHGKIGCILSILGSTVMVIHAPQEEEVTSLHEMEMKLRDPGFISFAVIITVISLVLILIVAPKKGQTNILVYISICSLIGAFSVSSVKGLGI 259          
BLAST of FC877881 vs. ExPASy Swiss-Prot
Match: NIPA2_PONAB (Magnesium transporter NIPA2 OS=Pongo abelii GN=NIPA2 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.592e-42
Identity = 91/190 (47.89%), Postives = 122/190 (64.21%), Query Frame = 2
Query:  314 IGFILAVVSSAFIGSSFIIXXXXXXXXXXXXXXXXXXXXXXXL-EPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGI 880
            IG  LA+ SS FIG SFI+                       L E LWW G+ +M  GE+ANF AY +APA LVTPLGALS++VSA+L+ + LNE+L   G +GCLL ++GST++V+HAP EE + ++ E+      P F+++   VV VAL+LI    PR+GQTNIL+YI ICSVIG+ +V  VK +GI
Sbjct:   12 IGLGLAMSSSIFIGGSFILKKKGLLRLARKGSMRAGQGGHAYLKEWLWWAGLLSMGAGEVANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGI 201          
BLAST of FC877881 vs. ExPASy Swiss-Prot
Match: NIPA2_HUMAN (Magnesium transporter NIPA2 OS=Homo sapiens GN=NIPA2 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.592e-42
Identity = 91/190 (47.89%), Postives = 122/190 (64.21%), Query Frame = 2
Query:  314 IGFILAVVSSAFIGSSFIIXXXXXXXXXXXXXXXXXXXXXXXL-EPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGI 880
            IG  LA+ SS FIG SFI+                       L E LWW G+ +M  GE+ANF AY +APA LVTPLGALS++VSA+L+ + LNE+L   G +GCLL ++GST++V+HAP EE + ++ E+      P F+++   VV VAL+LI    PR+GQTNIL+YI ICSVIG+ +V  VK +GI
Sbjct:   12 IGLGLAMSSSIFIGGSFILKKKGLLRLARKGSMRAGQGGHAYLKEWLWWAGLLSMGAGEVANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGI 201          
BLAST of FC877881 vs. ExPASy Swiss-Prot
Match: NIPA3_MOUSE (Magnesium transporter NIPA3 OS=Mus musculus GN=Nipal1 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 2.715e-42
Identity = 88/190 (46.32%), Postives = 123/190 (64.74%), Query Frame = 2
Query:  314 IGFILAVVSSAFIGSSFIIXXXXXXXXXXXXXXXXXXXXXXXL-EPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGI 880
            +G +LA+ SS FIGSSFI+                       L E LWW G+ +M  GE ANF AY +APA LVTPLGALS+++SA+L+ + LNE+L   G +GC+L V+GST++V+HAP E  + S+ E+ +    P F+ +   +  ++LVLIL  AP+ GQTNIL+YI ICS+IG+ +V SVK +GI
Sbjct:   70 VGLVLAISSSVFIGSSFILKKKGLLQLADKGITRAGQGGHSYLKEWLWWAGLLSMGAGEAANFAAYAFAPATLVTPLGALSVLISAILSSYFLNERLNIHGKIGCILSVLGSTVMVIHAPQEGEVTSLHEMEMKLRDPGFVSFAVIISVISLVLILIVAPKKGQTNILVYIAICSLIGAFSVSSVKGLGI 259          
BLAST of FC877881 vs. ExPASy Swiss-Prot
Match: NIPA2_MOUSE (Magnesium transporter NIPA2 OS=Mus musculus GN=Nipa2 PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.715e-42
Identity = 90/190 (47.37%), Postives = 121/190 (63.68%), Query Frame = 2
Query:  314 IGFILAVVSSAFIGSSFIIXXXXXXXXXXXXXXXXXXXXXXXL-EPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGI 880
            IG  LA+ SS FIG SFI+                       L E LWW G+ +M  GE+ANF AY +APA LVTPLGALS++VSA+L+ + LNE+L   G +GCLL ++GST++V+HAP EE + ++ E+      P F+++   VV VAL+ I    PR+GQTNIL+YI ICSVIG+ +V  VK +GI
Sbjct:   12 IGLGLAMTSSIFIGGSFILKKKGLLRLARKGSMRAGQGGHAYLKEWLWWAGLLSMGAGEVANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATFVVIVALIFIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGI 201          
BLAST of FC877881 vs. ExPASy Swiss-Prot
Match: NIPA2_BOVIN (Magnesium transporter NIPA2 OS=Bos taurus GN=NIPA2 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 7.900e-42
Identity = 89/190 (46.84%), Postives = 122/190 (64.21%), Query Frame = 2
Query:  314 IGFILAVVSSAFIGSSFIIXXXXXXXXXXXXXXXXXXXXXXXL-EPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGI 880
            IG  LA+ SS FIG SFI+                       L E LWW G+ +M  GE+ANF AY +APA LVTPLGALS++VSA+L+ + LNE+L   G +GCLL ++GST++V+HAP EE + ++ E+      P F+++   VV V+L+LI    PR+GQTNIL+YI ICSVIG+++V   K +GI
Sbjct:   12 IGLGLAMSSSIFIGGSFILKKKGLLRLARKGSTRAGQGGHAYLKEWLWWAGLLSMGAGEVANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVSLILIFVVGPRHGQTNILVYITICSVIGAVSVSCAKGLGI 201          
BLAST of FC877881 vs. ExPASy Swiss-Prot
Match: NIPA4_HUMAN (Magnesium transporter NIPA4 OS=Homo sapiens GN=NIPAL4 PE=1 SV=3)

HSP 1 Score: 162.925 bits (411), Expect = 2.151e-39
Identity = 84/190 (44.21%), Postives = 117/190 (61.58%), Query Frame = 2
Query:  314 IGFILAVVSSAFIGSSFIIXXXXXXXXXXXXXXXXXXXXXXXL-EPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGI 880
            IG  LA +SS  IGSS I+                       L + +WW G  TM  GE+ANF AY +APA +VTPLGALS+++SA+L+ + L E L  +G LGC++CV GST++V+HAP EE + ++ E+        F+++   ++   L+LI   APRYGQ NILIYI ICSVIG+ +V +VK +GI
Sbjct:  120 IGLGLAFLSSFLIGSSVILKKKGLLRLVATGATRAVDGGFGYLKDAMWWAGFLTMAAGEVANFGAYAFAPATVVTPLGALSVLISAILSSYFLRESLNLLGKLGCVICVAGSTVMVIHAPEEEKVTTIMEMASKMKDTGFIVFAVLLLVSCLILIFVIAPRYGQRNILIYIIICSVIGAFSVAAVKGLGI 309          
BLAST of FC877881 vs. ExPASy Swiss-Prot
Match: NIPA4_MOUSE (Magnesium transporter NIPA4 OS=Mus musculus GN=Nipal4 PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.810e-39
Identity = 84/190 (44.21%), Postives = 117/190 (61.58%), Query Frame = 2
Query:  314 IGFILAVVSSAFIGSSFIIXXXXXXXXXXXXXXXXXXXXXXXL-EPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGI 880
            IG  LA +S   IG+S I+                       L +P+WW GM TM  GE+ANF AY +APA +VTPLGALS+++SA+ + + L E L  +G LGC++C+ GST++V+HAP EE + +V E+        F+++   +V   L+LI   APRYGQ NILIYI ICSVIGS +V +VK +G+
Sbjct:   60 IGVGLAFLSCFLIGTSVILKKKGLIRLVATGATRAVNGGYGYLKDPMWWAGMATMSAGEVANFGAYAFAPATVVTPLGALSVLISAIFSSYCLGESLNLLGKLGCVICMAGSTVMVIHAPKEEKVTTVAEMASKMKDTGFIVFAVLLVVSCLILIFIVAPRYGQRNILIYIIICSVIGSFSVTAVKGLGV 249          
BLAST of FC877881 vs. ExPASy Swiss-Prot
Match: NIPA1_MOUSE (Magnesium transporter NIPA1 OS=Mus musculus GN=Nipa1 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.722e-34
Identity = 76/189 (40.21%), Postives = 111/189 (58.73%), Query Frame = 2
Query:  314 IGFILAVVSSAFIGSSFIIXXXXXXXXXXXXXXXXXXXXXXXLEPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGI 880
            +G  +AVVSS   GS+F++                        + +WW G   M VG+I NF+AY   P VLVTPLGAL +   ++LA ++L EKL  +G LGCLL   GS ++++H+P  ES+ +  E+    T P F+ Y+  V+ + L+LI + AP +G TNI++YI ICS++GS TV S K IG+
Sbjct:   24 LGLGVAVVSSLVNGSTFVLQKKGIVRAKRRGTSYLT-------DIVWWAGTIAMAVGQIGNFLAYTAVPTVLVTPLGALGVPFGSILASYLLKEKLNILGKLGCLLSCAGSVVLIIHSPKSESVTTQAELEEKLTNPVFVGYLCIVLLMLLLLIFWIAPAHGPTNIMVYISICSLLGSFTVPSTKGIGL 205          
The following BLAST results are available for this feature:
BLAST of FC877881 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
NIPA3_PONAB4.948e-4448.42Magnesium transporter NIPA3 OS=Pongo abelii GN=NIP... [more]
NIPA3_HUMAN1.880e-4347.37Magnesium transporter NIPA3 OS=Homo sapiens GN=NIP... [more]
NIPA2_PONAB1.592e-4247.89Magnesium transporter NIPA2 OS=Pongo abelii GN=NIP... [more]
NIPA2_HUMAN1.592e-4247.89Magnesium transporter NIPA2 OS=Homo sapiens GN=NIP... [more]
NIPA3_MOUSE2.715e-4246.32Magnesium transporter NIPA3 OS=Mus musculus GN=Nip... [more]
NIPA2_MOUSE2.715e-4247.37Magnesium transporter NIPA2 OS=Mus musculus GN=Nip... [more]
NIPA2_BOVIN7.900e-4246.84Magnesium transporter NIPA2 OS=Bos taurus GN=NIPA2... [more]
NIPA4_HUMAN2.151e-3944.21Magnesium transporter NIPA4 OS=Homo sapiens GN=NIP... [more]
NIPA4_MOUSE2.810e-3944.21Magnesium transporter NIPA4 OS=Mus musculus GN=Nip... [more]
NIPA1_MOUSE2.722e-3440.21Magnesium transporter NIPA1 OS=Mus musculus GN=Nip... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA60DA06RM1 IVIA1 Citrus clementina cDNA clone IC0AAA60DA06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877881 ID=FC877881|Name=FC877881|organism=Citrus clementina|type=EST|length=880bp
AAGGAGACAGACAAATTAGTAAAAAAATATGAACCAAAATCAAACCAAAT
CACTCTGACTGTGTAGTGTGTATCCTTTGAACGGAGCGGTCAACGTTCCT
CAAAATCACAGCAGAAGCTGCTGCTATTGCGTCTTGGAATCAATTTGTCG
ATAATCAATCATCAAAATCAATTATTGGAGTTATTAGTTAATAGCATCGG
GTCGGTTGGTCAATCACTCGCTGACGTGATGTGATGAGTGCCGTTCGATT
TCAATTACGTCGTCTGCTGCGGTCGTAACAAGAAGAAATAGATAGATGTT
CTCGAGTAATTTGATAGGCTTCATTTTGGCTGTGGTCTCAAGTGCCTTCA
TTGGCTCCAGCTTTATCATCAAGAAGAAGGGCCTCCGCAAGGCCGGCGCC
AACGGCGCTCGTGCTGGTTCTGGGGGTTATGGTTATTTGTTAGAGCCGCT
ATGGTGGGTTGGAATGTTTACGATGATAGTTGGAGAGATTGCCAATTTTG
TAGCATACATTTACGCCCCTGCAGTCCTGGTGACTCCACTTGGTGCATTG
AGTATCATCGTTAGTGCTGTTTTGGCACATTTCATGTTGAATGAGAAATT
ACAGAAAATGGGAATGTTGGGTTGTCTTTTATGCGTAGTGGGCTCTACAA
TGATTGTGCTTCATGCTCCTCTAGAGGAGTCTCTTAATTCGGTTCAAGAA
ATCTGGGTGTTAGCGACGCAACCCGCATTTCTTTTGTATGTGGGCTCAGT
GGTAGCCGTGGCACTAGTGTTGATATTGTATTGTGCTCCTCGATATGGCC
AAACCAACATATTGATCTATATAGGAATTTGCTCTGTGATTGGCTCATTG
ACAGTTATGAGTGTAAAAGCCATTGGCATT
back to top