FC877885

Overview
NameFC877885
Unique NameFC877885
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length834
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5255 contig Ccv1_Contig5255:1..834. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877885 vs. ExPASy Swiss-Prot
Match: WAX2_ARATH (Protein WAX2 OS=Arabidopsis thaliana GN=WAX2 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.131e-33
Identity = 80/271 (29.52%), Postives = 131/271 (48.34%), Query Frame = 1
Query:   37 FLTDWPWTPLGNFKYVVLAPWIIHSTYSFIVKDEKERELAYFVIFPLMLWRMLHNQIWISFSRYRTAKGSNRIVDKAIEFEQVDRERNWDDQIIFNGVLF----YVFVKILPGASQMPIWRLDGVILTALLHAGPVE-FXXXXXXXXXXXXXXXXXXXXXXXXXIVTEPITSVIHPFAEHIAYFALFAIPLITPLLSGMGSIASVLGYVTYIDFMNNMGHCNFELMPSCLLTNFPPLKYLAYTASFHSLHHTQFRTNYSLFMPVYDYIYGT 834
            FL+ WPW   GN KY++ AP      YS++ +++  + L    I  +   + L +++W  F+       + RI  K I+F+Q+D E +WD+ II   ++     Y+   ++   + +P+W   G+I   +LH    E                            V  P+T+      E+I    +  +PLI   L G+GS++++ GY    DFM  +GHCN E+    L    P L+YL YT ++HSLHH +  TN+ LFMP++D +  T
Sbjct:    4 FLSAWPWENFGNLKYLLYAPLAAQVVYSWVYEEDISKVLWCIHILIICGLKALVHELWSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIVSLICYMSPPLMMMINSLPLWNTKGLIALIVLHVTFSEPLYYFLHRSFHRNNYFFTHYHSFHHSSPVPHPMTAGNATLLENIILCVVAGVPLIGCCLFGVGSLSAIYGYAVMFDFMRCLGHCNVEIFSHKLFEILPVLRYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLGDT 274          
The following BLAST results are available for this feature:
BLAST of FC877885 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
WAX2_ARATH2.131e-3329.52Protein WAX2 OS=Arabidopsis thaliana GN=WAX2 PE=1 ... [more]
back to top
Properties
Property NameValue
Genbank descriptionIC0AAA49BE05RM1 IVIA1 Citrus clementina cDNA clone IC0AAA49BE05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877885 ID=FC877885|Name=FC877885|organism=Citrus clementina|type=EST|length=834bp
TCAAAGTGCAAACAAAGAATGGCTTCGAAACCTGGATTTCTCACTGATTG
GCCATGGACGCCTCTTGGAAACTTCAAGTACGTAGTATTGGCTCCTTGGA
TAATTCACAGCACGTACTCATTCATCGTAAAGGATGAGAAGGAGAGGGAG
CTAGCCTACTTTGTGATATTCCCATTGATGTTGTGGAGAATGCTTCACAA
CCAGATATGGATCAGCTTTTCCCGTTACCGAACAGCCAAAGGCAGTAACA
GAATCGTCGACAAGGCTATTGAATTCGAGCAAGTTGATAGAGAAAGAAAT
TGGGATGACCAAATAATATTCAACGGGGTCCTGTTTTACGTATTCGTTAA
AATACTTCCAGGCGCATCTCAAATGCCCATTTGGAGATTGGACGGTGTGA
TTCTCACAGCACTGCTGCATGCTGGTCCCGTGGAGTTCCTCTACTACTGG
CTTCACAGAGCACTCCATCATCATTACCTTTACTCTCGCTACCATTCCCA
CCACCATTCCTCCATCGTCACTGAACCTATCACTTCTGTGATTCATCCAT
TTGCAGAGCACATAGCGTACTTCGCACTATTTGCAATACCATTGATTACA
CCATTACTGAGTGGGATGGGCTCAATAGCATCCGTACTCGGTTACGTCAC
TTACATAGATTTTATGAACAACATGGGTCACTGCAATTTCGAACTCATGC
CCAGCTGCCTTCTCACCAACTTTCCTCCTCTCAAGTACCTCGCGTACACC
GCGTCGTTCCACTCACTGCATCACACGCAATTCCGGACCAATTATTCGTT
ATTTATGCCCGTATACGATTACATATATGGCACT
back to top