FC877889

Overview
NameFC877889
Unique NameFC877889
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length810
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15154 contig Ccv1_Contig15154:4..812. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877889 vs. ExPASy Swiss-Prot
Match: APR1_ARATH (5'-adenylylsulfate reductase 1, chloroplastic OS=Arabidopsis thaliana GN=APR1 PE=1 SV=2)

HSP 1 Score: 364.77 bits (935), Expect = 1.483e-103
Identity = 186/223 (83.41%), Postives = 202/223 (90.58%), Query Frame = 2
Query:  116 KVSQIGSFRLVDRAHVASTSLS---QRRSLVRPLNAEPKRNDSVVPLAATLATPEVAEKVEGEE--DFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEG 769
            KVSQIGS RL+DR HVA  SL+   +R S V+PLNAEPK  DS++PLAAT+   E+AE+VE  E  DFE+ AK+LENASPLEIMD+ALEK+GNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFD VEKH+GIRIEYMFPD+VEVQ LVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGL+AWITGQRKDQSPGTRSEIPVVQVDPVFEG
Sbjct:   27 KVSQIGSLRLLDRVHVAPVSLNLSGKRSSSVKPLNAEPKTKDSMIPLAATMVA-EIAEEVEVVEIEDFEELAKKLENASPLEIMDKALEKYGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDAVEKHYGIRIEYMFPDSVEVQGLVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLKAWITGQRKDQSPGTRSEIPVVQVDPVFEG 248          

HSP 2 Score: 33.8834 bits (76), Expect = 1.483e-103
Identity = 13/15 (86.67%), Postives = 15/15 (100.00%), Query Frame = 3
Query:  765 KGLEGGVGSLVKWNP 809
            +GL+GGVGSLVKWNP
Sbjct:  247 EGLDGGVGSLVKWNP 261          
BLAST of FC877889 vs. ExPASy Swiss-Prot
Match: APR3_ARATH (5'-adenylylsulfate reductase 3, chloroplastic OS=Arabidopsis thaliana GN=APR3 PE=2 SV=2)

HSP 1 Score: 338.576 bits (867), Expect = 1.058e-95
Identity = 178/247 (72.06%), Postives = 199/247 (80.57%), Query Frame = 2
Query:   41 MALAVTXXXXXXXXXXXXXXXXNDIKVSQIGSFRLVDRAHV--ASTSLSQRRSLVRPLNAEPKRNDSVVPLAATLATPEVAEKVE--GEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEG 769
            MALA+                 +D+KV++IGS RL++R +V  AS SLS +RS V+ LN +    +S+V         EV EK++    EDFE+ AK LENASPLEIMD+ALEKFGNDIAIAFSGAEDVALIEYAHLTGRP+RVFSLDTGRLNPETYR FD VEKH+GIRIEYMFPDAVEVQALVR+KGLFSFYEDGHQECCR+RKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEG
Sbjct:    1 MALAINVSSSSSSAISSSSFPSSDLKVTKIGSLRLLNRTNVSAASLSLSGKRSSVKALNVQSITKESIV-------ASEVTEKLDVVEVEDFEELAKRLENASPLEIMDKALEKFGNDIAIAFSGAEDVALIEYAHLTGRPYRVFSLDTGRLNPETYRLFDTVEKHYGIRIEYMFPDAVEVQALVRNKGLFSFYEDGHQECCRIRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEG 240          

HSP 2 Score: 33.8834 bits (76), Expect = 1.058e-95
Identity = 13/15 (86.67%), Postives = 15/15 (100.00%), Query Frame = 3
Query:  765 KGLEGGVGSLVKWNP 809
            +GL+GGVGSLVKWNP
Sbjct:  239 EGLDGGVGSLVKWNP 253          
BLAST of FC877889 vs. ExPASy Swiss-Prot
Match: APR2_ARATH (5'-adenylylsulfate reductase 2, chloroplastic OS=Arabidopsis thaliana GN=APR2 PE=2 SV=2)

HSP 1 Score: 331.257 bits (848), Expect = 1.653e-93
Identity = 172/222 (77.48%), Postives = 189/222 (85.14%), Query Frame = 2
Query:  107 NDIKVSQIGSFRLVDRAHVASTSLSQRRSLVRPLNAEP-KRNDSVVPLAATLATPEVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEG 769
            ++ K  QI S RL DR H     LSQRR  ++PLNAE   R++S V  A+TL  PEV EK    EDFEQ AK+LE+ASPLEIMD+ALE+FG+ IAIAFSGAEDVALIEYA LTG+PFRVFSLDTGRLNPETYR FD VEK +GIRIEYMFPDAVEVQALVR+KGLFSFYEDGHQECCRVRKVRPLRRALKGL+AWITGQRKDQSPGTRSEIP+VQVDPVFEG
Sbjct:   24 SESKALQICSIRLSDRTH-----LSQRRYSMKPLNAESHSRSESWVTRASTLIAPEVEEKGGEVEDFEQLAKKLEDASPLEIMDKALERFGDQIAIAFSGAEDVALIEYARLTGKPFRVFSLDTGRLNPETYRLFDAVEKQYGIRIEYMFPDAVEVQALVRNKGLFSFYEDGHQECCRVRKVRPLRRALKGLKAWITGQRKDQSPGTRSEIPIVQVDPVFEG 240          

HSP 2 Score: 33.8834 bits (76), Expect = 1.653e-93
Identity = 13/15 (86.67%), Postives = 15/15 (100.00%), Query Frame = 3
Query:  765 KGLEGGVGSLVKWNP 809
            +GL+GGVGSLVKWNP
Sbjct:  239 EGLDGGVGSLVKWNP 253          
BLAST of FC877889 vs. ExPASy Swiss-Prot
Match: CYSH_PSEAE (Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa GN=cysH PE=1 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 1.755e-45
Identity = 84/155 (54.19%), Postives = 113/155 (72.90%), Query Frame = 2
Query:  299 DFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVF 763
            D    A  L + SP +I+  A E FG+++ I+FSGAEDV L++ A    R  +VFSLDTGRL+PETYRF D+V +H+GI I+ + PD   ++ LV+ KGLFSFY DGH ECC +RK+ PL+R L G+RAW TGQR+DQSPGTRS++ V+++D  F
Sbjct:   29 DLPALASSLADKSPQDILKAAFEHFGDELWISFSGAEDVVLVDMAWKLNRNVKVFSLDTGRLHPETYRFIDQVREHYGIAIDVLSPDPRLLEPLVKEKGLFSFYRDGHGECCGIRKIEPLKRKLAGVRAWATGQRRDQSPGTRSQVAVLEIDGAF 183          
BLAST of FC877889 vs. ExPASy Swiss-Prot
Match: CYSH_PSEAB (Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysH PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.755e-45
Identity = 84/155 (54.19%), Postives = 113/155 (72.90%), Query Frame = 2
Query:  299 DFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVF 763
            D    A  L + SP +I+  A E FG+++ I+FSGAEDV L++ A    R  +VFSLDTGRL+PETYRF D+V +H+GI I+ + PD   ++ LV+ KGLFSFY DGH ECC +RK+ PL+R L G+RAW TGQR+DQSPGTRS++ V+++D  F
Sbjct:   29 DLPALASSLADKSPQDILKAAFEHFGDELWISFSGAEDVVLVDMAWKLNRNVKVFSLDTGRLHPETYRFIDQVREHYGIAIDVLSPDPRLLEPLVKEKGLFSFYRDGHGECCGIRKIEPLKRKLAGVRAWATGQRRDQSPGTRSQVAVLEIDGAF 183          
BLAST of FC877889 vs. ExPASy Swiss-Prot
Match: CYSH_PSEA8 (Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysH PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.755e-45
Identity = 84/155 (54.19%), Postives = 113/155 (72.90%), Query Frame = 2
Query:  299 DFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVF 763
            D    A  L + SP +I+  A E FG+++ I+FSGAEDV L++ A    R  +VFSLDTGRL+PETYRF D+V +H+GI I+ + PD   ++ LV+ KGLFSFY DGH ECC +RK+ PL+R L G+RAW TGQR+DQSPGTRS++ V+++D  F
Sbjct:   29 DLPALASSLADKSPQDILKAAFEHFGDELWISFSGAEDVVLVDMAWKLNRNVKVFSLDTGRLHPETYRFIDQVREHYGIAIDVLSPDPRLLEPLVKEKGLFSFYRDGHGECCGIRKIEPLKRKLAGVRAWATGQRRDQSPGTRSQVAVLEIDGAF 183          
BLAST of FC877889 vs. ExPASy Swiss-Prot
Match: CYSH_NEIMB (Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup B GN=cysH1 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.236e-16
Identity = 46/120 (38.33%), Postives = 70/120 (58.33%), Query Frame = 2
Query:  404 AEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFG-IRIEYMFPDAVEVQALVRSKGLFSFYE--DGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVD 754
            AED+ + +          +F+LDTG L+ ET    D + + +  +RI+   P   +    V SKG F+FY+  +  +ECCR+RK  PL RA+ G  AW+TGQR++QS  TR+E+P  + D
Sbjct:   53 AEDMVITDLIAGENLNIGIFTLDTGLLHTETLNLLDRLGRAYPHLRIKRFRPVREDADRYVESKGRFAFYDSVEARRECCRIRKTEPLNRAIAGADAWLTGQRREQS-ATRTELPFAEYD 171          
BLAST of FC877889 vs. ExPASy Swiss-Prot
Match: CYSH_NEIMA (Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup A GN=cysH PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.814e-16
Identity = 46/120 (38.33%), Postives = 71/120 (59.17%), Query Frame = 2
Query:  404 AEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFG-IRIEYMFPDAVEVQALVRSKGLFSFYE--DGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVD 754
            AED+ + +          +F+LDTG L+ ET    D +E+ +  ++I+   P   +    V SKG F+FY+  +  +ECCR+RK  PL RA+ G  AW+TGQR++QS  TR+E+P  + D
Sbjct:   51 AEDMVITDLIAGENLNIGIFTLDTGLLHAETLNLLDRIERVYPHMQIKRFQPIREDALHYVESKGRFAFYDSVEARRECCRIRKTEPLDRAIAGADAWLTGQRREQS-ATRTELPFAEYD 169          
BLAST of FC877889 vs. ExPASy Swiss-Prot
Match: CYSH_RHITR (Phosphoadenosine phosphosulfate reductase (Fragment) OS=Rhizobium tropici GN=cysH PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.472e-15
Identity = 42/99 (42.42%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  467 LDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYE--DGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDP 757
            L TGRL PET +  DE E  + IRI    P+  ++ A     GL  FYE  +    CC VRK++PL RAL G   W+TG R+ QS   R++ P  + DP
Sbjct:    1 LQTGRLFPETLKLIDETENQYDIRISRYEPEQADIDAYAEKYGLNGFYESVEARHACCGVRKLKPLARALSGATIWVTGLRRGQS-ANRADTPFAEYDP 98          
BLAST of FC877889 vs. ExPASy Swiss-Prot
Match: CYSH_AGRT5 (Phosphoadenosine phosphosulfate reductase OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=cysH PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.227e-14
Identity = 47/120 (39.17%), Postives = 61/120 (50.83%), Query Frame = 2
Query:  401 GAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYE--DGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVD 754
            G ED  +         P  V +L+TGRL  ET    DE E+ FGI I    P+  ++ A     GL  FYE  +    CC VRK+ PL +AL+G   WITG R+ QS G R+  P  + D
Sbjct:   52 GIEDQVITAAIGTHRLPIDVVTLETGRLFKETVDLIDETEERFGIEIRRFRPEQDDIDAYAAKYGLNGFYESVEARHACCHVRKLIPLGKALEGAAFWITGLRRGQS-GNRAATPFAEFD 170          
The following BLAST results are available for this feature:
BLAST of FC877889 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
APR1_ARATH1.483e-10383.415'-adenylylsulfate reductase 1, chloroplastic OS=A... [more]
APR3_ARATH1.058e-9572.065'-adenylylsulfate reductase 3, chloroplastic OS=A... [more]
APR2_ARATH1.653e-9377.485'-adenylylsulfate reductase 2, chloroplastic OS=A... [more]
CYSH_PSEAE1.755e-4554.19Phosphoadenosine phosphosulfate reductase OS=Pseud... [more]
CYSH_PSEAB1.755e-4554.19Phosphoadenosine phosphosulfate reductase OS=Pseud... [more]
CYSH_PSEA81.755e-4554.19Phosphoadenosine phosphosulfate reductase OS=Pseud... [more]
CYSH_NEIMB2.236e-1638.33Phosphoadenosine phosphosulfate reductase OS=Neiss... [more]
CYSH_NEIMA3.814e-1638.33Phosphoadenosine phosphosulfate reductase OS=Neiss... [more]
CYSH_RHITR2.472e-1542.42Phosphoadenosine phosphosulfate reductase (Fragmen... [more]
CYSH_AGRT51.227e-1439.17Phosphoadenosine phosphosulfate reductase OS=Agrob... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA94CE05RM1 IVIA1 Citrus clementina cDNA clone IC0AAA94CE05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877889 ID=FC877889|Name=FC877889|organism=Citrus clementina|type=EST|length=810bp
CAAACATAAACACAAACACAAACACAAAATTTCAATAATCATGGCCCTGG
CTGTAACTTCTTCAAATTCAATTTCAAGCTCCAGTTTTGCTCTTTCTAGT
TCTTCAAATGACATTAAAGTTTCACAAATCGGTTCTTTCCGGTTAGTGGA
CCGGGCACACGTGGCTTCCACGAGCCTCTCTCAACGACGTAGTTTAGTAA
GACCGTTGAATGCCGAGCCAAAACGAAACGATTCCGTGGTGCCTCTGGCA
GCAACTCTCGCTACCCCTGAAGTGGCGGAGAAAGTAGAAGGGGAGGAGGA
TTTTGAGCAATTTGCTAAGGAGCTTGAAAATGCGTCACCTCTTGAAATCA
TGGATAGAGCTCTTGAAAAGTTTGGAAATGACATAGCGATTGCTTTCAGT
GGTGCTGAAGATGTTGCTTTGATCGAGTATGCCCATTTAACTGGTAGACC
ATTTAGGGTGTTTAGCCTGGATACTGGAAGGCTAAACCCAGAAACATATA
GATTCTTTGACGAAGTTGAGAAACATTTTGGCATACGTATTGAATACATG
TTTCCCGATGCTGTTGAAGTTCAGGCATTAGTGAGGAGCAAGGGGCTCTT
CTCTTTCTATGAGGATGGGCACCAGGAGTGCTGCCGTGTGAGGAAAGTGA
GGCCCCTTCGGAGGGCCCTCAAGGGATTGCGTGCCTGGATCACTGGCCAA
AGGAAAGATCAGTCTCCAGGTACTAGGTCTGAAATCCCTGTAGTCCAGGT
GGATCCAGTTTTTGAAGGGGCTGGAAGGTGGGGTTGGCAGCCTGGTGAAA
TGGAATCCAG
back to top