FC877890

Overview
NameFC877890
Unique NameFC877890
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length819
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC877890_ssr641 microsatellite FC877890_ssr641:641..652. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig11793 contig Ccv1_Contig11793:26..844. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877890 vs. ExPASy Swiss-Prot
Match: EIF3G_XENTR (Eukaryotic translation initiation factor 3 subunit G OS=Xenopus tropicalis GN=eif3g PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.870e-27
Identity = 83/224 (37.05%), Postives = 115/224 (51.34%), Query Frame = 2
Query:  200 PKQVIGPDENG-VKKVIEYKFNDDGNKVKIXXXXRVRKLANARLSKRALERRNWAKFGDAVREDVGSRL--TMVSTEEILLERPRAPGSKPEETKAAGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPFKDLAAPAETFI-----------DKPXXXXXXXXXXGVTK-GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGA 817
            P++VI    NG +K + EYK ND+G K+KI    R  K+   + SK    R+NW KFG++  +  G  +  T VS + ++           +E +   + L      G  ++ CR C  KGDHWT+RCP+KD   P +  +           +K            V+K G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG+
Sbjct:   45 PQEVI----NGKIKTITEYKLNDEGKKIKIV---RTFKIETLKASKVVAHRKNWKKFGNSEYDPPGPNVATTTVSDDVLMTFITSKEDLNNQEEEDPMNKLK-----GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQKELAEQLGLSTGDKEKAPGAEPEPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGS 254          
BLAST of FC877890 vs. ExPASy Swiss-Prot
Match: EI3GA_XENLA (Eukaryotic translation initiation factor 3 subunit G-A OS=Xenopus laevis GN=eif3g-A PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.896e-27
Identity = 81/223 (36.32%), Postives = 112/223 (50.22%), Query Frame = 2
Query:  200 PKQVIGPDENGVKKVIEYKFNDDGNKVKIXXXXRVRKLANARLSKRALERRNWAKFGDAVREDVGSRL--TMVSTEEILLERPRAPGSKPEETKAAGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPFKDLAAPAETFI-----------DKPXXXXXXXXXXGVTK-GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGA 817
            P++VI      +K + EYK NDD   VKI    R  K+   + SK   +R+NW KFG++  +  G  +  T VS + ++           +E +   + L      G  ++ CR C  KGDHWT+RCP+KD   P +  +           +K            V+K G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG+
Sbjct:   43 PREVIN---GNIKTITEYKLNDDDKTVKIV---RTFKIETVKASKVVAQRKNWKKFGNSEYDPPGPNVATTTVSDDVLMTFITNKEDLNNQEEEDPMNKLK-----GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQKELAEQLGLSTGDKEKAPGAEPEPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGS 252          
BLAST of FC877890 vs. ExPASy Swiss-Prot
Match: EIF3G_MOUSE (Eukaryotic translation initiation factor 3 subunit G OS=Mus musculus GN=Eif3g PE=1 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 8.352e-27
Identity = 81/223 (36.32%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  197 PPKQVIGPDENGVKKVIEYKFNDDGNKVKIXXXXRVRKLANARLSKRALERRNWAKFGDAVREDVGSRL--TMVSTEEILLERPRAPGSKPEETKAAGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPFKDLAAPAETFI-----------DKPXXXXXXXXXXGVTKGTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGA 817
            PPK+VI      +K V EYK  +DG K KI    R+      + SK    R+NW KFG++  +  G  +  T VS +  +           +E +   + L      G  ++ CR C  KGDHWT+RCP+KD   P +  +           +K               G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG+
Sbjct:   55 PPKEVIN---GNIKTVTEYKIEEDGKKFKIVRTFRIE---TRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLK-----GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQAAQSKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGS 264          
BLAST of FC877890 vs. ExPASy Swiss-Prot
Match: EIF3G_HUMAN (Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens GN=EIF3G PE=1 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 8.352e-27
Identity = 81/223 (36.32%), Postives = 109/223 (48.88%), Query Frame = 2
Query:  197 PPKQVIGPDENGVKKVIEYKFNDDGNKVKIXXXXRVRKLANARLSKRALERRNWAKFGDAVREDVGSRL--TMVSTEEILLERPRAPGSKPEETKAAGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPFKDLAAPAETFI-----------DKPXXXXXXXXXXGVTKGTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGA 817
            PPK+VI      +K V EYK ++DG K KI    R+      + SK    R+NW KFG++  +  G  +  T VS +  +           +E +   + L      G  ++ CR C  KGDHWT+RCP+KD   P +  +           +K               G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG+
Sbjct:   55 PPKEVIN---GNIKTVTEYKIDEDGKKFKIVRTFRIE---TRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLK-----GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGS 264          
BLAST of FC877890 vs. ExPASy Swiss-Prot
Match: EIF3G_RAT (Eukaryotic translation initiation factor 3 subunit G OS=Rattus norvegicus GN=Eif3g PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.425e-26
Identity = 81/223 (36.32%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  197 PPKQVIGPDENGVKKVIEYKFNDDGNKVKIXXXXRVRKLANARLSKRALERRNWAKFGDAVREDVGSRL--TMVSTEEILLERPRAPGSKPEETKAAGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPFKDLAAPAETFI-----------DKPXXXXXXXXXXGVTKGTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGA 817
            PPK+VI      +K V EYK  +DG K KI    R+      + SK    R+NW KFG++  +  G  +  T VS +  +           +E +   + L      G  ++ CR C  KGDHWT+RCP+KD   P +  +           +K               G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG+
Sbjct:   55 PPKEVIN---GNIKTVTEYKVEEDGKKFKIVRTFRIE---TRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLK-----GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQAAQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGS 264          
BLAST of FC877890 vs. ExPASy Swiss-Prot
Match: EIF3G_DANRE (Eukaryotic translation initiation factor 3 subunit G OS=Danio rerio GN=eif3g PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.861e-26
Identity = 78/221 (35.29%), Postives = 109/221 (49.32%), Query Frame = 2
Query:  200 PKQVIGPDENGVKKVIEYKFNDDGNKVKIXXXXRVRKLANARLSKRALERRNWAKFGDAVREDVGSRL-TMVSTEEILLERPRAPGSKPEETKAAGDSLAQLGK-GGAVLMVCRTCGKKGDHWTSRCPFKDLAAPAETFIDKPXXXXXXXXXXGVTK----------GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGA 817
            PK+ +   +  +K V EYK +DDG K KI    R  K+   + SK    R+NW KFG++  +  G  + T   ++++ +       S  E+  A       + K  G  ++ CR C  KGDHWT+RCP+KD   P +  + +                         G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG+
Sbjct:   29 PKETV---KGNIKTVTEYKIDDDGQKFKII---RTFKIETRKASKAVARRKNWKKFGNSEYDAPGPNVATTTVSDDVFMTFI----SSKEDLNAQDQDEDPMNKLKGQKIVSCRIC--KGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKAAEPEPAQPVQNKTGKYVPPSLRDGGTRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGS 237          
BLAST of FC877890 vs. ExPASy Swiss-Prot
Match: EIF3G_BOVIN (Eukaryotic translation initiation factor 3 subunit G OS=Bos taurus GN=EIF3G PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.861e-26
Identity = 80/223 (35.87%), Postives = 109/223 (48.88%), Query Frame = 2
Query:  197 PPKQVIGPDENGVKKVIEYKFNDDGNKVKIXXXXRVRKLANARLSKRALERRNWAKFGDAVREDVGSRL--TMVSTEEILLERPRAPGSKPEETKAAGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPFKDLAAPAETFI-----------DKPXXXXXXXXXXGVTKGTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGA 817
            PPK+VI      +K V EY+ ++DG K KI    R+      + SK    R+NW KFG++  +  G  +  T VS +  +           +E +   + L      G  ++ CR C  KGDHWT+RCP+KD   P +  +           +K               G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG+
Sbjct:   55 PPKEVIN---GNIKTVTEYRIDEDGKKFKIVRTFRIE---TRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLK-----GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGS 264          
BLAST of FC877890 vs. ExPASy Swiss-Prot
Match: EI3GB_XENLA (Eukaryotic translation initiation factor 3 subunit G-B OS=Xenopus laevis GN=eif3g-B PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.861e-26
Identity = 80/223 (35.87%), Postives = 111/223 (49.78%), Query Frame = 2
Query:  200 PKQVIGPDENGVKKVIEYKFNDDGNKVKIXXXXRVRKLANARLSKRALERRNWAKFGDAVREDVGSRL--TMVSTEEILLERPRAPGSKPEETKAAGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPFKDLAAPAETFI-----------DKPXXXXXXXXXXGVTK-GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGA 817
            P++VI      +K + EYK ND   K+KI    R  K+   + SK    R+NW KFG++  +  G  +  T VS + ++           +E +   + L      G  ++ CR C  KGDHWT+RCP+KD   P +  +           +K            V+K G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG+
Sbjct:   43 PREVIN---GNIKTITEYKLNDKDKKIKIV---RTFKIETLKASKVVAHRKNWKKFGNSEYDPPGPNVATTTVSDDVLMTFITNKEDLNNQEEEDPMNKLK-----GQKIVSCRIC--KGDHWTTRCPYKDTLGPMQKELAEQLGLSTADKEKAPGAEPEPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGS 252          
BLAST of FC877890 vs. ExPASy Swiss-Prot
Match: EI3G2_DROAN (Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila ananassae GN=eIF3-S4-2 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.602e-23
Identity = 71/201 (35.32%), Postives = 100/201 (49.75%), Query Frame = 2
Query:  224 ENGVKKVIEYKFNDDGNKVKIXXXXRVRKLANARLSKRALERRNWAKFGDAVREDVG--SRLTMVSTEEILLERPRAPGSKPEETKA-AGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPFKDLAAPAETFIDKPXXXXXXXXXXGVTK-GTYVPPGMRAGAERTGTDMRRRNDENSVRVTNLSEDTREPDLLELFRPFG 814
            E   K V EYKFNDDG KVK+    ++ K     +SK    RR W KFGD+  +  G  S+ TM S E  +L        +  ET+  AG ++A+          CR C   G+HW+  CP+K  +  ++T ++              +K G YVPP M+ GA   G   R R+D ++VR++NLSE   E DL EL +  G
Sbjct:   28 EGDYKYVTEYKFNDDGKKVKVVRTFKIEKQV---VSKAVARRRGWVKFGDSRLDKPGPNSQTTMASEEIFMLFMGSKEFEQTHETQMDAGKNIAK----------CRICN--GEHWSVNCPYKGTSMDSKTLMESKANAAAAAALNDPSKPGKYVPPFMKDGAGGAGGKGRERDDSSAVRISNLSESMTETDLEELVKKIG 213          
BLAST of FC877890 vs. ExPASy Swiss-Prot
Match: EIF3G_SCHPO (Eukaryotic translation initiation factor 3 subunit G OS=Schizosaccharomyces pombe GN=tif35 PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 7.316e-23
Identity = 70/202 (34.65%), Postives = 108/202 (53.47%), Query Frame = 2
Query:  227 NGVKKVIEYKFNDDGNKVKIXXXXRVRKLANARLSKRALERRNWAKFGDAVREDVG--SRLTMVSTEEILLERPRAPGSKPEETKAAGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPFKDLAAPA-ETFIDKPXXXXXXXXXXGVTKGTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFG 814
            +G K +IE++ +D+G KVK+    R + +   R+     ER+ W KFG    ++ G  +R T V     L  +     +K EE   A  + A++   G+ ++ CR C  KG+H+T++CP+K +  P  E  +D            G  KG Y+ P +RAG+ R   D    R R+D  ++RVTNLS+DTRE +L +LFR FG
Sbjct:   29 DGTKTMIEFRIDDNGKKVKVTRVIR-KTVITERVQHAVAERKKWKKFGKEAGKNSGVDARTTSVGENVQLRLQLGWTTTKEEEQDEAALAAAKVKAKGSSVVRCRAC--KGNHFTAQCPYKSIIGPVDEPPLDASPVSSRASGALG-EKGRYIAPHLRAGSGRESGDSMFKRERDDSATLRVTNLSDDTREEELRDLFRRFG 226          
The following BLAST results are available for this feature:
BLAST of FC877890 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 66
Match NameE-valueIdentityDescription
EIF3G_XENTR2.870e-2737.05Eukaryotic translation initiation factor 3 subunit... [more]
EI3GA_XENLA4.896e-2736.32Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_MOUSE8.352e-2736.32Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_HUMAN8.352e-2736.32Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_RAT1.425e-2636.32Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_DANRE1.861e-2635.29Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_BOVIN1.861e-2635.87Eukaryotic translation initiation factor 3 subunit... [more]
EI3GB_XENLA1.861e-2635.87Eukaryotic translation initiation factor 3 subunit... [more]
EI3G2_DROAN5.602e-2335.32Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_SCHPO7.316e-2334.65Eukaryotic translation initiation factor 3 subunit... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAQ5YO06RM1 IVIA1 Citrus clementina cDNA clone KN0AAQ5YO06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877890 ID=FC877890|Name=FC877890|organism=Citrus clementina|type=EST|length=819bp
ATCTTTTTTAACTTTCACAAAAAATCGAAATCGCAAACCCTAAAACGCTT
TGTCTCGCATCCTCTCCAACGCTTGTGTTTTTCTTAATCTGATTCATTCG
AAAAAGATGTCGGTTTCGACTCAAAATCCGACCCAACCAAAGCTCCGTTG
GAGCGAACTGGACGAAGAAGACGGCGAGGATTTGGACTTCCTGCTGCCGC
CTAAACAAGTGATCGGCCCCGACGAGAACGGAGTCAAGAAAGTTATTGAA
TACAAGTTTAACGATGACGGCAATAAGGTCAAAATAACCACCACCACGCG
CGTGCGCAAGCTCGCTAACGCTCGTCTCAGCAAACGCGCGCTGGAGAGGA
GAAACTGGGCCAAGTTCGGCGACGCCGTTCGCGAAGACGTCGGTAGCAGA
CTTACCATGGTCTCCACCGAAGAGATCTTGCTGGAACGGCCTAGGGCTCC
TGGTAGCAAACCAGAAGAGACAAAGGCTGCAGGAGATTCCTTGGCGCAAC
TTGGGAAAGGTGGTGCTGTTCTCATGGTGTGTAGGACTTGTGGTAAGAAG
GGTGATCACTGGACGTCAAGGTGCCCTTTCAAGGATCTTGCTGCTCCAGC
TGAGACATTCATTGATAAACCAGCTGCATCAGAGACTGCAGCTGCTGCTG
CTGGCGTGACCAAGGGAACATATGTTCCTCCTGGCATGAGAGCAGGGGCG
GAGAGAACTGGAACCGATATGAGACGCAGGAATGATGAGAACTCTGTTAG
GGTCACCAACCTATCGGAGGACACTCGGGAACCTGACTTGCTTGAGCTCT
TCCGACCTTTTGGTGCTGT
back to top