FC877895

Overview
NameFC877895
Unique NameFC877895
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length884
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11587 contig Ccv1_Contig11587:17..900. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877895 vs. ExPASy Swiss-Prot
Match: GUN10_ARATH (Endoglucanase 10 OS=Arabidopsis thaliana GN=At1g75680 PE=2 SV=2)

HSP 1 Score: 253.447 bits (646), Expect = 1.217e-66
Identity = 122/195 (62.56%), Postives = 145/195 (74.36%), Query Frame = 3
Query:  306 MGEKSKSKGCFGWFXXXXXXXXXXGAIVYTIK---KKTSHSDKXXXXXXXXXXXEKKYAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPMAFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGHPDKDHKCWERPESMAEGRPLTQVN 881
            M EKSKS+G  GWF           A+VYT+K   KK+   D            +KKYA+ALK+A+QFFD+QKSGKL NNKI WRGDS LKDG +  LDL+KG+YDAGDH+KFGFPMAFTATVLSW+ILEYGDQM+ V+QL PA+DSL+WITDYLI AHP +NVL +QVG P  DH CWERPE M E RPLT+++
Sbjct:    1 MEEKSKSRGWCGWFIAIIVLASVILAVVYTVKLRTKKSGDDDGGGPVPGPPGAIDKKYADALKLALQFFDIQKSGKLENNKIPWRGDSGLKDGSEDNLDLSKGLYDAGDHIKFGFPMAFTATVLSWSILEYGDQMNAVNQLDPAKDSLRWITDYLIKAHPSDNVLYIQVGDPKVDHPCWERPEDMKEKRPLTKID 195          
BLAST of FC877895 vs. ExPASy Swiss-Prot
Match: GUN24_ORYSJ (Endoglucanase 24 OS=Oryza sativa subsp. japonica GN=Os09g0533900 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 7.642e-61
Identity = 113/194 (58.25%), Postives = 134/194 (69.07%), Query Frame = 3
Query:  318 SKSKGCFGWFXXXXXXXXXXGAIVYTIKKK-----TSHSDKXXXXXXXXXXXEKKYAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPMAFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGHPDKDHKCWERPESMAEGRPLTQVNT 884
            SK+KGC GW            A V  I KK     +    K           + KY +AL VA+QFF VQK+GKL NN+I WRGDSAL DG+  GLDL+KGMYDAGDH+KF FPMAFTATVLSW+ILEYGDQM    QL PA D+L+WITD+L++AHP +NV  +QVG PD DH CWERPE+M+E RPLTQ+NT
Sbjct:    3 SKTKGCCGWLIVALVASLVATAAVVAIMKKKVGGGSGRKLKPLPVPGPPGAIDSKYGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGDHIKFSFPMAFTATVLSWSILEYGDQMSATKQLDPALDALRWITDFLVNAHPSDNVFYIQVGDPDLDHNCWERPETMSEKRPLTQINT 196          
BLAST of FC877895 vs. ExPASy Swiss-Prot
Match: GUN2_ARATH (Endoglucanase 2 OS=Arabidopsis thaliana GN=At1g19940 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 3.550e-58
Identity = 105/168 (62.50%), Postives = 131/168 (77.98%), Query Frame = 3
Query:  381 AIVYTIKKKTSHSDKXXXXXXXXXXXEKKYAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPMAFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGHPDKDHKCWERPESMAEGRPLTQVNT 884
            A+++TI+ +++HSD             K YA ALK+AMQFFD+QKSGKL NN+ISWRGDS LKDG +  +DL+KG+YDAGDHMKFGFPMAFTATVLSW+ILEYGDQM  ++ L  A+DSLKW TD+LI+AHP  NVL +QVG P  DHKCW+RPE+M   R LT+++T
Sbjct:   27 AVIFTIRHRSNHSDDDGSNV-------KNYANALKIAMQFFDIQKSGKLENNEISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGFPMAFTATVLSWSILEYGDQMASLNLLDHAKDSLKWTTDFLINAHPSPNVLYIQVGDPVTDHKCWDRPETMTRKRTLTKIDT 187          
BLAST of FC877895 vs. ExPASy Swiss-Prot
Match: GUN18_ORYSJ (Endoglucanase 18 OS=Oryza sativa subsp. japonica GN=Os06g0715300 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.673e-55
Identity = 97/140 (69.29%), Postives = 115/140 (82.14%), Query Frame = 3
Query:  459 EKKYAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPMAFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGHPDKDHKCWERPESMAEGRPLTQV 878
            + KYA+AL VA+QFF VQKSGKLVNN I WRGDSAL DG++ G+DL+KGMYDAGDHMKFGFPMAFTAT+LSW++LEYGD M   DQ   A D+L WI DYL++AHP ++VL +QVG P  DHKCWERPE M E RPLT++
Sbjct:   47 DHKYADALAVALQFFQVQKSGKLVNNTIHWRGDSALDDGKEAGIDLSKGMYDAGDHMKFGFPMAFTATMLSWSVLEYGDAMRAADQRDSAIDALNWIMDYLVNAHPSDDVLYIQVGDPKADHKCWERPEKMKEKRPLTKI 186          
BLAST of FC877895 vs. ExPASy Swiss-Prot
Match: GUN4_THEFU (Endoglucanase E-4 OS=Thermomonospora fusca GN=celD PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 9.090e-38
Identity = 77/139 (55.40%), Postives = 97/139 (69.78%), Query Frame = 3
Query:  468 YAEALKVAMQFFDVQKSGKLV-NNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPMAFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGHPDKDHKCWERPESMAEGRPLTQVN 881
            YAEAL+ +M F++ Q+SGKL  NN++SWRGDS L DG D+GLDLT G YDAGDH+KFGFPMAFTAT+L+W  +E  +      Q+   +D+L+W+ DY I AHP  NVL VQVG  D DHK W   E M   RP  +V+
Sbjct:   52 YAEALQKSMFFYEAQRSGKLPENNRVSWRGDSGLNDGADVGLDLTGGWYDAGDHVKFGFPMAFTATMLAWGAIESPEGYIRSGQMPYLKDNLRWVNDYFIKAHPSPNVLYVQVGDGDADHKWWGPAEVMPMERPSFKVD 190          
BLAST of FC877895 vs. ExPASy Swiss-Prot
Match: GUN12_ARATH (Endoglucanase 12 OS=Arabidopsis thaliana GN=At2g44540 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.187e-37
Identity = 74/133 (55.64%), Postives = 96/133 (72.18%), Query Frame = 3
Query:  468 YAEALKVAMQFFDVQKSGKLV-NNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPMAFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGHPDKDHKCWERPESMAEGR 863
            YAEAL+ ++ +F+ Q+SGKL  N K++WRGDSALKDG D  +DLT G YDAGD+MKFGFP+AFT T+L+W+ +E G ++    +   +  +LKW TDYLI AHP+ NVL  QVG  + DHKCW RPE M   R
Sbjct:   34 YAEALQKSLLYFEAQRSGKLPPNQKVTWRGDSALKDGSDAHIDLTGGYYDAGDNMKFGFPLAFTTTMLAWSNIEMGSELRAHHEQGNSLRALKWATDYLIKAHPQPNVLYGQVGEGNSDHKCWMRPEDMTTPR 166          
BLAST of FC877895 vs. ExPASy Swiss-Prot
Match: GUN13_ARATH (Endoglucanase 13 OS=Arabidopsis thaliana GN=At2g44550 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 2.645e-37
Identity = 74/133 (55.64%), Postives = 95/133 (71.43%), Query Frame = 3
Query:  468 YAEALKVAMQFFDVQKSGKLV-NNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPMAFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGHPDKDHKCWERPESMAEGR 863
            YAEALK ++ +F+ Q+SGKL  N +++WRGDSAL+DG D  +DLT G YDAGD+MKFGFP+AFT T+L+W+ +E   Q+    +   A  +LKW TDYLI AHP+ NVL  QVG  + DHKCW RPE M   R
Sbjct:   34 YAEALKNSLLYFEAQRSGKLPPNQRVTWRGDSALRDGSDAHIDLTGGYYDAGDNMKFGFPLAFTTTMLAWSNIEMASQLRAHHEKGNALRALKWATDYLIKAHPQPNVLYGQVGEGNSDHKCWMRPEDMTTPR 166          
BLAST of FC877895 vs. ExPASy Swiss-Prot
Match: GUN5_ORYSJ (Endoglucanase 5 OS=Oryza sativa subsp. japonica GN=Os02g0151300 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.924e-36
Identity = 70/139 (50.36%), Postives = 93/139 (66.91%), Query Frame = 3
Query:  468 YAEALKVAMQFFDVQKSGKL-VNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPMAFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGHPDKDHKCWERPESMAEGRPLTQVN 881
            Y EAL  ++ +F+ Q+SG+L  N ++ WRG S L DG + G+DL  G YDAGDH+KFG PMAFT T+LSW++LEYG+++    +L  A  ++KW TDY I AH   NVL  QVG  D DH CW+RPE M   R   +V+
Sbjct:   30 YGEALSKSLLYFEAQRSGRLPYNQRVRWRGHSGLTDGLEQGVDLVGGYYDAGDHVKFGLPMAFTVTMLSWSVLEYGEEIAAAGELGHALHAIKWGTDYFIKAHTHPNVLWTQVGDGDSDHYCWQRPEDMTTSRHAYKVD 168          
BLAST of FC877895 vs. ExPASy Swiss-Prot
Match: GUN15_ORYSJ (Endoglucanase 15 OS=Oryza sativa subsp. japonica GN=Os05g0212300 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.514e-36
Identity = 71/139 (51.08%), Postives = 95/139 (68.35%), Query Frame = 3
Query:  468 YAEALKVAMQFFDVQKSGKLV-NNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPMAFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGHPDKDHKCWERPESMAEGRPLTQVN 881
            YA AL+ ++ +F  Q+SG L  N ++SWR  S L DG+  G+DL  G YDAGD++KFG PMAFT T++SW+ILEYG QM    +L+ A D++KW TDY I AHP+ +VL  +VG  D DH CW+RPE M   R   +V+
Sbjct:   35 YAMALRKSILYFQAQRSGVLPPNQRVSWRASSGLFDGKANGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSILEYGKQMAAAGELRNAMDAVKWGTDYFIKAHPEPDVLYGEVGDGDTDHSCWQRPEDMTTSRQAFRVD 173          
BLAST of FC877895 vs. ExPASy Swiss-Prot
Match: GUN14_ARATH (Endoglucanase 14 OS=Arabidopsis thaliana GN=At2g44560 PE=2 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 8.508e-36
Identity = 69/141 (48.94%), Postives = 99/141 (70.21%), Query Frame = 3
Query:  462 KKYAEALKVAMQFFDVQKSGKLVNN-KISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPMAFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGHPDKDHKCWERPESMAEGRPLTQVN 881
            + Y +AL  ++ +F+ Q+SGKL +N +++WRGDSAL+DG D  +DLT G YDAGD+MKFGFP+AF  T+L+W+ +E   Q+    + + A  +LKW TD+LI AHP+ NVL  QVG  + DH+CW RPE M   RP  +++
Sbjct:   32 RNYGDALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGFPLAFFTTMLAWSNIEMATQLKAHQEQENALAALKWATDFLIKAHPEPNVLYGQVGDGNSDHECWMRPEDMTTPRPSFRID 172          
The following BLAST results are available for this feature:
BLAST of FC877895 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 62
Match NameE-valueIdentityDescription
GUN10_ARATH1.217e-6662.56Endoglucanase 10 OS=Arabidopsis thaliana GN=At1g75... [more]
GUN24_ORYSJ7.642e-6158.25Endoglucanase 24 OS=Oryza sativa subsp. japonica G... [more]
GUN2_ARATH3.550e-5862.50Endoglucanase 2 OS=Arabidopsis thaliana GN=At1g199... [more]
GUN18_ORYSJ3.673e-5569.29Endoglucanase 18 OS=Oryza sativa subsp. japonica G... [more]
GUN4_THEFU9.090e-3855.40Endoglucanase E-4 OS=Thermomonospora fusca GN=celD... [more]
GUN12_ARATH1.187e-3755.64Endoglucanase 12 OS=Arabidopsis thaliana GN=At2g44... [more]
GUN13_ARATH2.645e-3755.64Endoglucanase 13 OS=Arabidopsis thaliana GN=At2g44... [more]
GUN5_ORYSJ2.924e-3650.36Endoglucanase 5 OS=Oryza sativa subsp. japonica GN... [more]
GUN15_ORYSJ6.514e-3651.08Endoglucanase 15 OS=Oryza sativa subsp. japonica G... [more]
GUN14_ARATH8.508e-3648.94Endoglucanase 14 OS=Arabidopsis thaliana GN=At2g44... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA94CE06RM1 IVIA1 Citrus clementina cDNA clone IC0AAA94CE06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877895 ID=FC877895|Name=FC877895|organism=Citrus clementina|type=EST|length=884bp
AAAATAAAATAACGAATAAACCCGCGTGACTGACCTCTGTCGGTGATCAA
AGAAATTAAAGAAAATTGACGATCTGATTTGTCCCAGACCCAGCTGCTTC
AATTGTATTGTATTAGAGAATTTGCAAAACTGATTCAGCAGCCAAATTAA
GCTTCTTACCACTCACATTTCACCCACTAGAGAGAAATACGGTGCTGCGT
TTTTCACCGTTTGAAGACCCTACGCACAAAGCTCTTACTCTCTTCACCCA
ATGCCGGCATTTTGAGTTAGATTTAGATCTGAGAACTTGACGGCATTGTG
TTAAAATGGGGGAGAAATCAAAGTCCAAGGGTTGTTTCGGATGGTTCTTG
GTCCTAGTCCTATTGGCTCTAGTTGTTGGCGCAATTGTTTACACTATTAA
AAAGAAAACAAGTCACTCTGATAAGCCGGCTCCAGTTCCCGGTCCCCCCG
GCGCCGTCGAGAAAAAGTATGCTGAAGCCCTCAAAGTCGCAATGCAGTTC
TTCGACGTACAAAAATCGGGAAAGTTGGTGAATAATAAGATATCATGGAG
AGGGGATTCGGCTCTTAAAGATGGAAGAGACATGGGTTTGGATCTCACAA
AAGGCATGTATGATGCTGGGGATCATATGAAGTTTGGGTTTCCGATGGCT
TTTACTGCGACTGTGTTGTCGTGGGCCATCCTTGAGTATGGAGATCAGAT
GGACGTTGTGGATCAGTTGCAACCAGCTCAGGATTCTCTCAAGTGGATCA
CTGATTATCTTATCAGTGCTCATCCCAAAGAGAATGTCCTTATTGTTCAG
GTGGGGCATCCTGATAAGGACCACAAATGTTGGGAAAGACCTGAAAGCAT
GGCTGAAGGGAGACCACTCACTCAGGTCAACACA
back to top