FC877896

Overview
NameFC877896
Unique NameFC877896
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length923
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10472 contig Ccv1_Contig10472:1..923. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877896 vs. ExPASy Swiss-Prot
Match: QKIL1_ARATH (KH domain-containing protein At4g26475 OS=Arabidopsis thaliana GN=At4g26475 PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.291e-74
Identity = 136/157 (86.62%), Postives = 150/157 (95.54%), Query Frame = 1
Query:  451 MQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGLVS 921
            + SS A NWL+S GSSSGLIVKRTIRVDIPV+KYPN+NFVGRLLGPRGNSLKRVEAST+CRVLIRGRGSIKDP +E+MMRGKPGYEHLNEPLHILVEAELP+EIVDARLMQAREIL+DLL PV+E+HDFYKKQQLRELA+LNG+LREEGSPMSG +S
Sbjct:  138 VSSSPAPNWLNSPGSSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMRGKPGYEHLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSIS 294          
BLAST of FC877896 vs. ExPASy Swiss-Prot
Match: QKIL2_ARATH (KH domain-containing protein At5g56140 OS=Arabidopsis thaliana GN=At5g56140 PE=2 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 3.179e-73
Identity = 135/155 (87.10%), Postives = 145/155 (93.55%), Query Frame = 1
Query:  457 SSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGLVS 921
            SS   NWL+S GSSSGLI KRTIRVDIPV+ YPNFNFVGRLLGPRGNSLKRVEAST+CRVLIRGRGSIKDP +EEMMRGKPGYEHLNEPLHILVEAELP+EIVDARLMQAREIL+DLL P++E+HD YKKQQLRELA+LNGTLREEGSPMSG VS
Sbjct:  146 SSPGPNWLNSPGSSSGLIAKRTIRVDIPVDNYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPMEETHDMYKKQQLRELALLNGTLREEGSPMSGSVS 300          
BLAST of FC877896 vs. ExPASy Swiss-Prot
Match: QKIL4_ARATH (KH domain-containing protein At3g08620 OS=Arabidopsis thaliana GN=At3g08620 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 5.638e-54
Identity = 101/152 (66.45%), Postives = 123/152 (80.92%), Query Frame = 1
Query:  466 AQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGLVS 921
            A  W  +  S S   VKR +R+D+PV+ YPNFNFVGRLLGPRGNSLKRVEA+T CRV IRG+GSIKDP +EE ++GKPGYEHLNE LHIL+EA+LP++IVD +L QA+EI+E+L+KPVDES D+ K+QQLRELA+LN  LRE     SG VS
Sbjct:  118 AMEWQGAPASPSSYPVKRILRLDLPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPEKEEKLKGKPGYEHLNEQLHILIEADLPIDIVDIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNSNLRENSPGPSGSVS 269          
BLAST of FC877896 vs. ExPASy Swiss-Prot
Match: QKIL3_ARATH (KH domain-containing protein At2g38610 OS=Arabidopsis thaliana GN=At2g38610 PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 8.141e-53
Identity = 104/160 (65.00%), Postives = 125/160 (78.12%), Query Frame = 1
Query:  436 RISGLMQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLN-GTLREEGSPMSG 912
            R+SG        +W  + GS S   VKR +R++IPV+ YPNFNFVGRLLGPRGNSLKRVEA+T CRV IRG+GSIKDP +E+ +RG+PGYEHLNE LHIL+EA+LP  IV+ RL QA+EI+E+LLKPVDES DF K+QQLRELA+LN   LREE    SG
Sbjct:  111 RLSGT--PGMTMDWQGAPGSPSSYTVKRILRLEIPVDNYPNFNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDPEKEDKLRGRPGYEHLNEQLHILIEADLPASIVEIRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNNLREESPGPSG 268          
BLAST of FC877896 vs. ExPASy Swiss-Prot
Match: QKIL5_ARATH (KH domain-containing protein At1g09660 OS=Arabidopsis thaliana GN=At1g09660 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 8.425e-50
Identity = 95/151 (62.91%), Postives = 119/151 (78.81%), Query Frame = 1
Query:  463 SAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGL 915
            S   W+   G  +  IVK+ IR+D+PV+KYP++NFVGR+LGPRGNSLKRVE +T CRV IRGRGS+KD  +EE ++GKPGYEHL EPLH+L+EAELP +I+++RL  A   LE LLKP+DES D YK++QL+ELA LNGTLREE SP   L
Sbjct:  129 SPVGWIGMPGLPNPPIVKKVIRLDVPVDKYPSYNFVGRILGPRGNSLKRVELATHCRVFIRGRGSVKDTVKEEKLKGKPGYEHLCEPLHVLIEAELPEDIINSRLEHAVHFLESLLKPMDESMDHYKREQLKELAALNGTLREE-SPSPSL 278          
BLAST of FC877896 vs. ExPASy Swiss-Prot
Match: QKIA_XENLA (Protein quaking-A OS=Xenopus laevis GN=qki-A PE=1 SV=2)

HSP 1 Score: 136.732 bits (343), Expect = 1.765e-31
Identity = 68/147 (46.26%), Postives = 98/147 (66.67%), Query Frame = 1
Query:  451 MQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLRE 891
            M SSS +   S      G IV+   ++ +PV++YP+FNFVGR+LGPRG + K++EA T C++++RG+GS++D  +EE  RGKP +EHLNE LH+L+  E      + +L +A E ++ LL P  E  D  KK QL ELA+LNGT R+
Sbjct:   61 MNSSSNEKRTSELPDGIGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAELKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRD 207          
BLAST of FC877896 vs. ExPASy Swiss-Prot
Match: QKI_RAT (Protein quaking OS=Rattus norvegicus GN=Qki PE=1 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 3.328e-30
Identity = 63/130 (48.46%), Postives = 92/130 (70.77%), Query Frame = 1
Query:  502 GLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLRE 891
            G IV+   ++ +PV++YP+FNFVGR+LGPRG + K++EA T C++++RG+GS++D  +EE  RGKP +EHLNE LH+L+  E      + +L +A E ++ LL P  E  D  KK QL ELA+LNGT R+
Sbjct:   77 GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRD 206          
BLAST of FC877896 vs. ExPASy Swiss-Prot
Match: QKI_PIG (Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 3.328e-30
Identity = 63/130 (48.46%), Postives = 92/130 (70.77%), Query Frame = 1
Query:  502 GLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLRE 891
            G IV+   ++ +PV++YP+FNFVGR+LGPRG + K++EA T C++++RG+GS++D  +EE  RGKP +EHLNE LH+L+  E      + +L +A E ++ LL P  E  D  KK QL ELA+LNGT R+
Sbjct:   77 GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRD 206          
BLAST of FC877896 vs. ExPASy Swiss-Prot
Match: QKI_MOUSE (Protein quaking OS=Mus musculus GN=Qki PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 3.328e-30
Identity = 63/130 (48.46%), Postives = 92/130 (70.77%), Query Frame = 1
Query:  502 GLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLRE 891
            G IV+   ++ +PV++YP+FNFVGR+LGPRG + K++EA T C++++RG+GS++D  +EE  RGKP +EHLNE LH+L+  E      + +L +A E ++ LL P  E  D  KK QL ELA+LNGT R+
Sbjct:   77 GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRD 206          
BLAST of FC877896 vs. ExPASy Swiss-Prot
Match: QKI_HUMAN (Protein quaking OS=Homo sapiens GN=QKI PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 3.328e-30
Identity = 63/130 (48.46%), Postives = 92/130 (70.77%), Query Frame = 1
Query:  502 GLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLRE 891
            G IV+   ++ +PV++YP+FNFVGR+LGPRG + K++EA T C++++RG+GS++D  +EE  RGKP +EHLNE LH+L+  E      + +L +A E ++ LL P  E  D  KK QL ELA+LNGT R+
Sbjct:   77 GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRD 206          
The following BLAST results are available for this feature:
BLAST of FC877896 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 47
Match NameE-valueIdentityDescription
QKIL1_ARATH1.291e-7486.62KH domain-containing protein At4g26475 OS=Arabidop... [more]
QKIL2_ARATH3.179e-7387.10KH domain-containing protein At5g56140 OS=Arabidop... [more]
QKIL4_ARATH5.638e-5466.45KH domain-containing protein At3g08620 OS=Arabidop... [more]
QKIL3_ARATH8.141e-5365.00KH domain-containing protein At2g38610 OS=Arabidop... [more]
QKIL5_ARATH8.425e-5062.91KH domain-containing protein At1g09660 OS=Arabidop... [more]
QKIA_XENLA1.765e-3146.26Protein quaking-A OS=Xenopus laevis GN=qki-A PE=1 ... [more]
QKI_RAT3.328e-3048.46Protein quaking OS=Rattus norvegicus GN=Qki PE=1 S... [more]
QKI_PIG3.328e-3048.46Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1[more]
QKI_MOUSE3.328e-3048.46Protein quaking OS=Mus musculus GN=Qki PE=1 SV=1[more]
QKI_HUMAN3.328e-3048.46Protein quaking OS=Homo sapiens GN=QKI PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAQ5YO07RM1 IVIA1 Citrus clementina cDNA clone KN0AAQ5YO07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877896 ID=FC877896|Name=FC877896|organism=Citrus clementina|type=EST|length=923bp
CTACGGTAGGCAGCCACTAGTTAGATTAGCGAGTGTGTGTCTGGTCGGGA
TCATCCCACCAGCTACACAAATCTGCAGACAGCCGAACGCCACCTTCGTC
ATCATCAATCATCGCAATCTTCCGTCCGCCGTACGCTTCTCATCGCCGAT
CGTACCGCTGAAGCCACCGCCTGGATCTGATAAAGTGACCCGACGGCGAC
GACCGTAGACACTAACAGCAGAAAACTAACTTAACGATGGCGTCATCAGG
TGGAGGCAGGTTCATGGCCTACTCGCTGTCACCTTCTGCTCCTCACTCTC
CTCACCTCCCCTCTCTCCGCTCCGCATCCTCCGCTATCCTCGATCAAGAA
AAATATCTCTCTGAGTTACTAGCTGAGCGTCATAAGCTTAATCCATTCCT
GCCTGTGTTACCGAATGCTTACCGGCTGTTGAACCAGGATTTCTGGTTTA
ATGCAGTCATCATCAGCACAAAACTGGCTTAGCTCACAAGGTAGCTCATC
AGGTCTCATTGTTAAGAGGACAATCAGAGTGGATATTCCAGTCGAAAAAT
ATCCTAATTTCAACTTTGTCGGGCGCCTCCTTGGTCCTCGAGGCAACTCG
CTTAAGCGAGTCGAAGCTAGTACAGAATGCCGTGTTCTGATTAGGGGACG
CGGCAGTATAAAGGATCCAGCAAGGGAAGAAATGATGAGAGGAAAACCTG
GGTATGAACATTTGAATGAGCCTCTCCATATCCTGGTTGAGGCAGAATTG
CCAGTTGAGATAGTTGATGCTCGCCTAATGCAAGCACGTGAGATACTTGA
AGATTTGCTCAAGCCTGTGGATGAATCCCATGATTTCTACAAGAAACAAC
AACTGCGAGAGCTTGCAATGCTCAATGGTACACTTCGTGAAGAAGGGTCT
CCAATGTCTGGGTTAGTGTCCCC
back to top