FC877902

Overview
NameFC877902
Unique NameFC877902
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length923
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig2318 contig Ccv1_Contig2318:1..923. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877902 vs. ExPASy Swiss-Prot
Match: RFC4_MOUSE (Replication factor C subunit 4 OS=Mus musculus GN=Rfc4 PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 9.894e-67
Identity = 95/166 (57.23%), Postives = 119/166 (71.69%), Query Frame = 3
Query:  426 LELNASDERGIQVVRDKVKTFAQLTVSRTRPDGRPCPPYKLVILDEADSMTNAAQAALXXXXXXXXXXXXFCLICNYVSRIIPPITSRCSKFRFKPLSRENVIKRLKEICASEGVDVGSGSVLEQAVDTCGGDLRRALTAMQCCQRLYG--QITLDGLFEVTGLVP 917
            LELNASDERGIQVVR+KVK FAQLTVS +R DG+PCPP+K+VILDEADSMT+AAQAAL            FCLICNYVSRII P+TSRCSKFRFKPLS +   +RL +I   E V +G+  +    V    GDLR+A+T +Q   RL G  +++ D + ++ G++P
Sbjct:  106 LELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQERLLDIAEKENVKIGNEEI-AYLVKISEGDLRKAITFLQSATRLTGGKEVSEDVITDIAGVIP 270          

HSP 2 Score: 97.0561 bits (240), Expect = 9.894e-67
Identity = 52/97 (53.61%), Postives = 62/97 (63.92%), Query Frame = 2
Query:  134 MQAFLKTGKISNNEK-------PASSVXXXXXXXXXXXXWVEKYRPKTIDDIVDQGEVVQVLRECLAGGDLPHLLFYGPPGTGKTSAILAAARQLFG 403
            MQAFLK   +S   +       PA++             WVEKYRPK +D++  Q EVV VLR+ L G DLP+LLFYGPPGTGKTS ILAAAR+LFG
Sbjct:    1 MQAFLKGTSVSAKAQLTKDRGTPATAGSSGETKKVKPVPWVEKYRPKCVDEVAFQDEVVAVLRKSLEGADLPNLLFYGPPGTGKTSTILAAARELFG 97          
BLAST of FC877902 vs. ExPASy Swiss-Prot
Match: RFC4_HUMAN (Replication factor C subunit 4 OS=Homo sapiens GN=RFC4 PE=1 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 5.303e-65
Identity = 96/166 (57.83%), Postives = 117/166 (70.48%), Query Frame = 3
Query:  426 LELNASDERGIQVVRDKVKTFAQLTVSRTRPDGRPCPPYKLVILDEADSMTNAAQAALXXXXXXXXXXXXFCLICNYVSRIIPPITSRCSKFRFKPLSRENVIKRLKEICASEGVDVGSGSVLEQAVDTCGGDLRRALTAMQCCQRLYG--QITLDGLFEVTGLVP 917
            LELNASDERGIQVVR+KVK FAQLTVS +R DG+PCPP+K+VILDEADSMT+AAQAAL            FCLICNYVSRII P+TSRCSKFRFKPLS +   +RL +I   E V + S   +   V    GDLR+A+T +Q   RL G  +IT   + ++ G++P
Sbjct:  106 LELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKI-SDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIP 270          

HSP 2 Score: 93.9745 bits (232), Expect = 5.303e-65
Identity = 52/97 (53.61%), Postives = 60/97 (61.86%), Query Frame = 2
Query:  134 MQAFLKTGKISNNEK-------PASSVXXXXXXXXXXXXWVEKYRPKTIDDIVDQGEVVQVLRECLAGGDLPHLLFYGPPGTGKTSAILAAARQLFG 403
            MQAFLK   IS            AS+             WVEKYRPK +D++  Q EVV VL++ L G DLP+LLFYGPPGTGKTS ILAAAR+LFG
Sbjct:    1 MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFG 97          
BLAST of FC877902 vs. ExPASy Swiss-Prot
Match: RFC2_YEAST (Replication factor C subunit 2 OS=Saccharomyces cerevisiae GN=RFC2 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 5.607e-55
Identity = 89/173 (51.45%), Postives = 108/173 (62.43%), Query Frame = 3
Query:  426 LELNASDERGIQVVRDKVKTFAQLTVSRTRP---DGRPCPPYKLVILDEADSMTNAAQAALXXXXXXXXXXXXFCLICNYVSRIIPPITSRCSKFRFKPLSRENVIKRLKEICASEGVDVGSGSVLEQAVDTCGGDLRRALTAMQCCQR---LYG---QITLDGLFEVTGLVP 917
            LELNASDERGI +VR+KVK FA+LTVS+      +  PCPPYK++ILDEADSMT  AQ+AL            FCLICNYV+RII P+ SRCSKFRFK L   N I RL+ I   E V    G VLE+ +D   GDLRR +T +Q   +     G    IT   + E+ G+VP
Sbjct:   93 LELNASDERGISIVREKVKNFARLTVSKPSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPLASRCSKFRFKALDASNAIDRLRFISEQENVKCDDG-VLERILDISAGDLRRGITLLQSASKGAQYLGDGKNITSTQVEELAGVVP 264          

HSP 2 Score: 82.8037 bits (203), Expect = 5.607e-55
Identity = 36/66 (54.55%), Postives = 49/66 (74.24%), Query Frame = 2
Query:  230 WVEKYRPKTIDDIVDQGEVVQVLRECLAGGDLPHLLFYGPPGTGKTSAILAAARQLFG-DISRDRV 424
            WVEKYRPK +D++  Q   V VL++ L   +LPH+LFYGPPGTGKTS ILA  ++L+G D+ + R+
Sbjct:   27 WVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPHMLFYGPPGTGKTSTILALTKELYGPDLMKSRI 92          
BLAST of FC877902 vs. ExPASy Swiss-Prot
Match: RFC4_DICDI (Probable replication factor C subunit 4 OS=Dictyostelium discoideum GN=rfc4 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.260e-50
Identity = 78/166 (46.99%), Postives = 102/166 (61.45%), Query Frame = 3
Query:  426 LELNASDERGIQVVRDKVKTFAQLTVSRTRPD-GRPCPPYKLVILDEADSMTNAAQAALXXXXXXXXXXXXFCLICNYVSRIIPPITSRCSKFRFKPLSRENVIKRLKEICASEGVDVGSGSVLEQAVDTCGGDLRRALTAMQCCQRLY-GQITLDGLFEVTGLVP 917
            LELNASDERGI+VVR K+K FA   V++T      P   +KL+ILDEADSMT  AQAAL            FCL+CNY+SRII P+ SRC+KFRFKPL     I+RLK I   EG+     SV +       GD+R+A+T +Q   R +  +I+ D ++ + G +P
Sbjct:   78 LELNASDERGIEVVRTKIKNFAGYAVNKTTTGTSNPGATFKLIILDEADSMTTDAQAALRRTIETTSKTTRFCLLCNYISRIIDPLASRCAKFRFKPLDTVATIERLKFISQQEGIKC-EESVYQAIQVVSNGDMRKAITYLQSAFRFFANKISEDVIYNIAGSLP 242          

HSP 2 Score: 83.1889 bits (204), Expect = 2.260e-50
Identity = 38/66 (57.58%), Postives = 50/66 (75.76%), Query Frame = 2
Query:  230 WVEKYRPKTIDDIVDQGEVVQVLRECLAGGDLPHLLFYGPPGTGKTSAILAAARQLFG-DISRDRV 424
            WV KYRPKT+DD+  Q +V+  L++ L  G+LPHLLFYGPPGTGKTS ILA A  ++G ++ + RV
Sbjct:   12 WVAKYRPKTVDDVSYQEDVISALKKSLNTGNLPHLLFYGPPGTGKTSTILAIAMDIYGPELMKQRV 77          
BLAST of FC877902 vs. ExPASy Swiss-Prot
Match: RFCS_AERPE (Replication factor C small subunit OS=Aeropyrum pernix GN=rfcS PE=3 SV=3)

HSP 1 Score: 134.42 bits (337), Expect = 1.003e-47
Identity = 77/166 (46.39%), Postives = 107/166 (64.46%), Query Frame = 3
Query:  426 LELNASDERGIQVVRDKVKTFAQLTVSRTRPDGRPCPPYKLVILDEADSMTNAAQAALXXXXXXXXXXXXFCLICNYVSRIIPPITSRCSKFRFKPLSRENVIKRLKEICASEGVDVGSGSVLEQAVDTCGGDLRRALTAMQCCQRLYGQITLDGLFEVTGLVPDR 923
            LELNASDERGI V+R+KVK FA+   SRT P+     P+K+V+LDEAD+MT+ AQ AL            F LI NY S+II PI SRC+ FRF+PLS+++VI+RL+ I  +EGVD      L+   +   GD+R+A+  +Q    L G++T+D ++ V G+   R
Sbjct:   74 LELNASDERGINVIREKVKEFAR---SRTPPE----IPFKIVLLDEADNMTSDAQQALRRLMELYSSVTRFILIANYPSKIIDPIQSRCAFFRFQPLSKQDVIERLRYIAENEGVDY-EEEALDAIYEISEGDMRKAINVLQAASYL-GKVTVDAVYRVVGMAKPR 230          

HSP 2 Score: 77.7962 bits (190), Expect = 1.003e-47
Identity = 35/59 (59.32%), Postives = 46/59 (77.97%), Query Frame = 2
Query:  230 WVEKYRPKTIDDIVDQGEVVQVLRECLAGGDLPHLLFYGPPGTGKTSAILAAARQLFGD 406
            WVEKYRP+++DDIVDQ  VV+ L++ +   ++PHLLF GPPGTGKT+A  A A  LFG+
Sbjct:    9 WVEKYRPRSLDDIVDQKHVVERLKQFVKQRNMPHLLFAGPPGTGKTTAAHALAHDLFGE 67          
BLAST of FC877902 vs. ExPASy Swiss-Prot
Match: RFCS_ARCFU (Replication factor C small subunit OS=Archaeoglobus fulgidus GN=rfcS PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.003e-47
Identity = 75/161 (46.58%), Postives = 98/161 (60.87%), Query Frame = 3
Query:  423 FLELNASDERGIQVVRDKVKTFAQLTVSRTRPDGRPCPPYKLVILDEADSMTNAAQAALXXXXXXXXXXXXFCLICNYVSRIIPPITSRCSKFRFKPLSRENVIKRLKEICASEGVDVGSGSVLEQAVDTCGGDLRRALTAMQCCQRLYGQITLDGLFEVT 905
            F+E+NASDERGI VVR K+K FA     RT P G    P+K++ LDEAD++T  AQAAL            F L CNYVSRII PI SRC+ FRFKP+ +E + KRL EIC  EGV +     LE  +   GGD R+A+ A+Q    +   +  D ++++T
Sbjct:   71 FIEMNASDERGIDVVRHKIKEFA-----RTAPIGGA--PFKIIFLDEADALTADAQAALRRTMEMYSKSCRFILSCNYVSRIIEPIQSRCAVFRFKPVPKEAMKKRLLEICEKEGVKITEDG-LEALIYISGGDFRKAINALQGAAAIGEVVDADTIYQIT 223          

HSP 2 Score: 80.4925 bits (197), Expect = 1.003e-47
Identity = 36/63 (57.14%), Postives = 48/63 (76.19%), Query Frame = 2
Query:  230 WVEKYRPKTIDDIVDQGEVVQVLRECLAGGDLPHLLFYGPPGTGKTSAILAAARQLFGDISRD 418
            WVEKYRP+T+D++V Q EV+Q L+  +   ++PHLLF GPPGTGKT+  +A AR LFG+  RD
Sbjct:    7 WVEKYRPRTLDEVVGQDEVIQRLKGYVERKNIPHLLFSGPPGTGKTATAIALARDLFGENWRD 69          
BLAST of FC877902 vs. ExPASy Swiss-Prot
Match: RFC4_CAEEL (Replication factor C subunit 4 OS=Caenorhabditis elegans GN=rfc-4 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.703e-47
Identity = 65/142 (45.77%), Postives = 92/142 (64.79%), Query Frame = 3
Query:  426 LELNASDERGIQVVRDKVKTFAQLTVSRTRPDGRPCPPYKLVILDEADSMTNAAQAALXXXXXXXXXXXXFCLICNYVSRIIPPITSRCSKFRFKPLSRENVIKRLKEICASEGVDVGSGSVLEQAVDTCGGDLRRALTAMQ 851
            L+LNASDERGI VVR K+++F++ ++  +  +       K++ILDE D+MT  AQAA+            F LICNYVSR+IPP+ SRC+KFRFK L  E  ++RL+ IC +EG  + S   L+Q ++   GDLRRA+  +Q
Sbjct:   83 LDLNASDERGIAVVRQKIQSFSKSSLGHSHRED--VLKLKIIILDEVDAMTREAQAAMRRVIEDFSKTTRFILICNYVSRLIPPVVSRCAKFRFKSLPAEIQVQRLRTICDAEGTPM-SDDELKQVMEYSEGDLRRAVCTLQ 221          

HSP 2 Score: 90.5077 bits (223), Expect = 1.703e-47
Identity = 46/66 (69.70%), Postives = 50/66 (75.76%), Query Frame = 2
Query:  230 WVEKYRPKTIDDIVDQGEVVQVLRECLAGGDLPHLLFYGPPGTGKTSAILAAARQLF-GDISRDRV 424
            W EKYRPKT+DDI  Q EVV +L+  L G DLPHLLFYGPPGTGKTSA LA  RQLF  +I  DRV
Sbjct:   17 WTEKYRPKTLDDIAYQDEVVTMLKGALQGRDLPHLLFYGPPGTGKTSAALAFCRQLFPKNIFHDRV 82          
BLAST of FC877902 vs. ExPASy Swiss-Prot
Match: RFCS_STAMF (Replication factor C small subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=rfcS PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 6.947e-46
Identity = 77/166 (46.39%), Postives = 99/166 (59.64%), Query Frame = 3
Query:  426 LELNASDERGIQVVRDKVKTFAQLTVSRTRPDGRPCPPYKLVILDEADSMTNAAQAALXXXXXXXXXXXXFCLICNYVSRIIPPITSRCSKFRFKPLSRENVIKRLKEICASEGVDVGSGSVLEQAVDTCGGDLRRALTAMQCCQRLYGQITLDGLFEVTGLVPDR 923
            LELNASDERGI V+R KVK FA+  V+   P       +K+V+LDEAD+MT  AQ AL            F LI NY S+II PI SRC+ FRF PL +E+VI RLK I   E V++     LE   D   GD+RRA+  +Q    L G++T+D +++V GL   R
Sbjct:   78 LELNASDERGIDVIRSKVKEFARTRVAANIP-------FKIVLLDEADNMTADAQQALRRLMEMYTATTRFILIANYPSKIIEPIQSRCAVFRFAPLKKEDVISRLKWIAEQEKVEIDE-EALEAIHDLSEGDMRRAINILQAAAAL-GKVTVDSVYKVVGLAHPR 234          

HSP 2 Score: 76.6406 bits (187), Expect = 6.947e-46
Identity = 34/59 (57.63%), Postives = 44/59 (74.58%), Query Frame = 2
Query:  230 WVEKYRPKTIDDIVDQGEVVQVLRECLAGGDLPHLLFYGPPGTGKTSAILAAARQLFGD 406
            W EKYRPKT+D+IVDQ E+V  L++ +   ++PHLLF GPPGTGKT+A    A  LFG+
Sbjct:   13 WAEKYRPKTLDEIVDQEEIVSRLKQFVKERNMPHLLFAGPPGTGKTTAAHCLAHDLFGE 71          
BLAST of FC877902 vs. ExPASy Swiss-Prot
Match: RFCS_THEPD (Replication factor C small subunit OS=Thermofilum pendens (strain Hrk 5) GN=rfcS PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 7.535e-45
Identity = 71/163 (43.56%), Postives = 95/163 (58.28%), Query Frame = 3
Query:  426 LELNASDERGIQVVRDKVKTFAQLTVSRTRPDGRPCPPYKLVILDEADSMTNAAQAALXXXXXXXXXXXXFCLICNYVSRIIPPITSRCSKFRFKPLSRENVIKRLKEICASEGVDVGSGSVLEQAVDTCGGDLRRALTAMQCCQRLYGQITLDGLFEVTGLV 914
            LELNASDERGI V+R ++K +A     RT P G    P+KLVILDEAD+MT  AQ AL            F LI NY S+II PI SRC+ FRF+PL + +  +RL+ I   EG+ V  G+ LE   +   GDLR+A+  +Q    +   +T + ++   G V
Sbjct:   71 LELNASDERGIDVIRSRIKDYA-----RTLPIGDV--PFKLVILDEADNMTGDAQQALRRTMELFSRNTRFILIANYASKIIEPIQSRCAVFRFQPLPKGDAFQRLRWIAQQEGITVDDGA-LEAIWEESQGDLRKAINTLQAASAISRNVTEEVVYAALGRV 225          

HSP 2 Score: 83.1889 bits (204), Expect = 7.535e-45
Identity = 37/63 (58.73%), Postives = 50/63 (79.37%), Query Frame = 2
Query:  230 WVEKYRPKTIDDIVDQGEVVQVLRECLAGGDLPHLLFYGPPGTGKTSAILAAARQLFGDISRD 418
            WVEKYRP+++D+IVDQ E+V+ L+E +   ++PHLLF GPPGTGKT+A LA A  L+G+  RD
Sbjct:    6 WVEKYRPRSLDEIVDQEEIVKRLKEFVKNKNMPHLLFAGPPGTGKTTAALALAHDLYGESWRD 68          
BLAST of FC877902 vs. ExPASy Swiss-Prot
Match: RFCS_SULAC (Replication factor C small subunit OS=Sulfolobus acidocaldarius GN=rfcS PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.173e-44
Identity = 71/163 (43.56%), Postives = 99/163 (60.74%), Query Frame = 3
Query:  423 FLELNASDERGIQVVRDKVKTFAQLTVSRTRPDGRPCPPYKLVILDEADSMTNAAQAALXXXXXXXXXXXXFCLICNYVSRIIPPITSRCSKFRFKPLSRENVIKRLKEICASEGVDVGSGSVLEQAVDTCGGDLRRALTAMQCCQRLYGQITLDGLFEVTGL 911
            FLELNASDERGI V+R+KVK FA+   S          P+K+++LDEAD+MT  AQ AL            F L CNY+S+II PI SR + FRF PL +E+V+ RL +I  +E V+     + E   D   GD+R+A+  +Q     YG+IT++ +++V GL
Sbjct:   71 FLELNASDERGIDVIRNKVKEFARTVASNN-------VPFKVILLDEADNMTADAQQALRRTMELYTETTRFILACNYLSKIIEPIQSRTALFRFYPLKKEDVVNRLIQIAKNEKVEFDPKGI-ETIFDITQGDMRKAINVIQAAS-AYGKITVETVYKVLGL 224          

HSP 2 Score: 76.6406 bits (187), Expect = 2.173e-44
Identity = 33/59 (55.93%), Postives = 47/59 (79.66%), Query Frame = 2
Query:  230 WVEKYRPKTIDDIVDQGEVVQVLRECLAGGDLPHLLFYGPPGTGKTSAILAAARQLFGD 406
            W EKYRPK++D+IV+Q E+V+ L++ +   ++PHLLF GPPGTGKT+A LA  R L+G+
Sbjct:    7 WAEKYRPKSLDEIVNQKEIVERLKKFVKEKNMPHLLFAGPPGTGKTTAALALVRDLYGN 65          
The following BLAST results are available for this feature:
BLAST of FC877902 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 94
Match NameE-valueIdentityDescription
RFC4_MOUSE9.894e-6757.23Replication factor C subunit 4 OS=Mus musculus GN=... [more]
RFC4_HUMAN5.303e-6557.83Replication factor C subunit 4 OS=Homo sapiens GN=... [more]
RFC2_YEAST5.607e-5551.45Replication factor C subunit 2 OS=Saccharomyces ce... [more]
RFC4_DICDI2.260e-5046.99Probable replication factor C subunit 4 OS=Dictyos... [more]
RFCS_AERPE1.003e-4746.39Replication factor C small subunit OS=Aeropyrum pe... [more]
RFCS_ARCFU1.003e-4746.58Replication factor C small subunit OS=Archaeoglobu... [more]
RFC4_CAEEL1.703e-4745.77Replication factor C subunit 4 OS=Caenorhabditis e... [more]
RFCS_STAMF6.947e-4646.39Replication factor C small subunit OS=Staphylother... [more]
RFCS_THEPD7.535e-4543.56Replication factor C small subunit OS=Thermofilum ... [more]
RFCS_SULAC2.173e-4443.56Replication factor C small subunit OS=Sulfolobus a... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA100AD06RM1 IVIA1 Citrus clementina cDNA clone IC0AAA100AD06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877902 ID=FC877902|Name=FC877902|organism=Citrus clementina|type=EST|length=923bp
CTGTCAGAAACTGGCGGGTAAAAAATGTACAAAGCAGGCAGCCAGATCTT
ATAAGTCAACAAAATAAATACAAAACAGATGAATAAAAGCTAACTAAAAT
AGCTTGTTATTTAGTTACCTAAAAGCTTTAATAATGCAGGCATTCCTTAA
AACGGGTAAGATATCCAACAATGAAAAACCAGCATCATCAGTTCCGAAAA
CTGGCGGCAAGAAGAAACCACCGGCACCATGGGTAGAGAAATACCGTCCC
AAGACTATAGACGATATAGTAGACCAAGGTGAAGTAGTGCAAGTATTGCG
GGAATGTTTGGCGGGTGGTGACTTGCCGCATCTTCTGTTCTACGGGCCTC
CGGGTACTGGTAAAACTAGTGCTATCCTGGCGGCTGCTCGGCAACTATTT
GGAGACATCAGCAGAGACCGGGTTTTTGGAGCTCAATGCTTCTGATGAAC
GGGGCATACAAGTAGTCAGGGATAAAGTGAAGACATTTGCACAGCTCACA
GTCAGCAGGACACGACCTGATGGCCGACCATGTCCTCCGTATAAGCTGGT
TATTCTGGATGAAGCTGACTCCATGACCAACGCAGCCCAGGCGGCACTGC
GACGTACCATGGAGAAGGAAACCAGGACCACGAGATTCTGTTTAATCTGC
AACTATGTGTCAAGGATCATCCCGCCTATTACTAGCAGATGTTCCAAGTT
TAGATTCAAACCACTTTCAAGAGAAAATGTTATTAAAAGGTTAAAAGAGA
TCTGTGCAAGCGAAGGCGTGGACGTGGGCAGTGGGTCAGTGCTGGAGCAG
GCGGTGGACACGTGCGGCGGGGACCTGCGCCGCGCGCTCACCGCCATGCA
GTGCTGCCAGAGACTCTACGGGCAGATCACTCTGGACGGACTCTTCGAGG
TGACGGGGCTGGTGCCTGACCGG
back to top