FC877903

Overview
NameFC877903
Unique NameFC877903
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length844
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3467 contig Ccv1_Contig3467:1..844. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877903 vs. ExPASy Swiss-Prot
Match: MPI_SCHPO (Mannose-6-phosphate isomerase OS=Schizosaccharomyces pombe GN=pmi40 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.910e-38
Identity = 83/187 (44.39%), Postives = 109/187 (58.29%), Query Frame = 3
Query:  255 LLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDIDKPYAEFWMGTHESGPSFLXXXXXXXXXXXXXXXXXXXXXXCGEIVSLKSWILKNPNVLGDKVLHRWGCDLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEVLCSFISLQELKSVLQNVPEIVELVGSE 815
            + RL C V+ Y WG+ G +SL +KL     G   D + PYAE WMG+H SGPSF+                       G+ +S     L  P  +G+KV  ++G  LPFLFKVLS+ K LSIQAHPDK L K LHK  P  YKDDNHKPEMA+A+TEF+ LC F  +++++  L ++  + E VG E
Sbjct:    1 MYRLKCDVKSYGWGKVGHESLAAKLAEAGYGFEVDPNTPYAELWMGSHPSGPSFVMQT--------------------GKPLSE----LLTPETVGEKVYKKYGKQLPFLFKVLSINKVLSIQAHPDKPLGKQLHKTNPKEYKDDNHKPEMAVALTEFDALCGFRPVKQIEQFLDSIAPLREFVGEE 163          
BLAST of FC877903 vs. ExPASy Swiss-Prot
Match: MPI_ECHMU (Probable mannose-6-phosphate isomerase OS=Echinococcus multilocularis GN=PMIH PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 2.281e-35
Identity = 85/188 (45.21%), Postives = 111/188 (59.04%), Query Frame = 3
Query:  255 LLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKR-TDIDKPYAEFWMGTHESGPSFLXXXXXXXXXXXXXXXXXXXXXXCGEIVSLKSWILKNPNVLGDKVLHRWGCDLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEVLCSFISLQELKSVLQNVPEIVELVGSE 815
            +LRL C+ Q+YDWG+ G +S+V KL   +     + +D PYAE WMGTH SG S L                          V+L + I +NP  LG   L  +G  LPFLFKVLSVAKALSIQAHPDK++A  LH   P++YKD +HKPEMA+A+T+FE L  F  L ++ + +Q  PE+ EL   E
Sbjct:    1 MLRLKCASQRYDWGKVGVNSIVYKLQVASENPDISHVDLPYAELWMGTHPSGSSCLWDNPH---------------------VTLAAHIQENPASLGKPSLIYFGRRLPFLFKVLSVAKALSIQAHPDKKMAVRLHAEQPDLYKDGSHKPEMAIALTDFEALLGFRPLNQILAFIQAFPELAELTTLE 167          
BLAST of FC877903 vs. ExPASy Swiss-Prot
Match: MPI_PANTR (Mannose-6-phosphate isomerase OS=Pan troglodytes GN=MPI PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 8.667e-35
Identity = 85/198 (42.93%), Postives = 113/198 (57.07%), Query Frame = 3
Query:  243 AARRLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDI--DKPYAEFWMGTHESGPSFLXXXXXXXXXXXXXXXXXXXXXXCGEIVSLKSWILKNPNVLGDKVLHRWGCDLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEVLCSFISLQELKSVLQNVPEIVELVGSEEANRV 830
            AA R+  L+C+VQ+Y WG+ GS+S V++L   +S     I  DKPYAE WMGTH  G + +                           +L  WI +N + LG KV   +  +LPFLFKVLSV   LSIQAHP+KELA+ LH   P  Y D NHKPEMA+A+T F+ LC F  ++E+ + L+ VPE   L+G E A  +
Sbjct:    2 AAPRVFPLSCAVQQYAWGKMGSNSEVARLLA-SSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQK-------------------TLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHL 179          
BLAST of FC877903 vs. ExPASy Swiss-Prot
Match: MPI_HUMAN (Mannose-6-phosphate isomerase OS=Homo sapiens GN=MPI PE=1 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 8.667e-35
Identity = 85/198 (42.93%), Postives = 113/198 (57.07%), Query Frame = 3
Query:  243 AARRLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDI--DKPYAEFWMGTHESGPSFLXXXXXXXXXXXXXXXXXXXXXXCGEIVSLKSWILKNPNVLGDKVLHRWGCDLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEVLCSFISLQELKSVLQNVPEIVELVGSEEANRV 830
            AA R+  L+C+VQ+Y WG+ GS+S V++L   +S     I  DKPYAE WMGTH  G + +                           +L  WI +N + LG KV   +  +LPFLFKVLSV   LSIQAHP+KELA+ LH   P  Y D NHKPEMA+A+T F+ LC F  ++E+ + L+ VPE   L+G E A  +
Sbjct:    2 AAPRVFPLSCAVQQYAWGKMGSNSEVARLLA-SSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQK-------------------TLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHL 179          
BLAST of FC877903 vs. ExPASy Swiss-Prot
Match: MPI_YEAST (Mannose-6-phosphate isomerase OS=Saccharomyces cerevisiae GN=PMI40 PE=1 SV=4)

HSP 1 Score: 146.362 bits (368), Expect = 1.931e-34
Identity = 84/201 (41.79%), Postives = 112/201 (55.72%), Query Frame = 3
Query:  246 ARRLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDI--DKPYAEFWMGTHESGPSFLXXXXXXXXXXXXXXXXXXXXXXCGEIVSLKSWILKNPN-VLGDKVLHRWGC--DLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEVLCSFISLQELKSVLQNVPEIVELVGSEEANRVL 833
            + +L RL    Q+YDWG+ GS S V++ +  +S     I  DKPYAE WMGTH   PS+                            SL+  I KNP+ +LG  ++ ++    +LPFLFKVLS+ K LSIQAHPDK L K LH   P  Y DDNHKPEMA+A+T+FE  C F  LQE+   L+ +PE+  +VG E +   +
Sbjct:    2 SNKLFRLDAGYQQYDWGKIGSSSAVAQ-FAAHSDPSVQIEQDKPYAELWMGTHSKMPSYNHESKE----------------------SLRDIISKNPSAMLGKDIIDKFHATNELPFLFKVLSIEKVLSIQAHPDKALGKILHAQDPKNYPDDNHKPEMAIAVTDFEGFCGFKPLQEIADELKRIPELRNIVGEETSRNFI 179          
BLAST of FC877903 vs. ExPASy Swiss-Prot
Match: MPI_CANGA (Mannose-6-phosphate isomerase OS=Candida glabrata GN=PMI1 PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 3.293e-34
Identity = 86/199 (43.22%), Postives = 110/199 (55.28%), Query Frame = 3
Query:  252 RLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDID--KPYAEFWMGTHESGPSFLXXXXXXXXXXXXXXXXXXXXXXCGEIVSLKSWILKNPN-VLGDKVLHRWGC--DLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEVLCSFISLQELKSVLQNVPEIVELVGSEEANRVL 833
            R  RL    Q+YDWG+ GS S V+K +  +S     ID  KPYAE WMGTH   PS                             +L   + KN   ++G+ V++++    +LPFLFKVLS+ K LSIQAHPDKEL K LH   P  Y DDNHKPEMA+AITEFE  C F  L+E+   L+ +PE  ++VG E AN  +
Sbjct:    5 RFFRLDAGYQQYDWGKIGSSSAVAK-FAAHSDPSVKIDETKPYAELWMGTHSKLPSVNHETK----------------------ATLNDILAKNSQELIGEDVINKFKSTNELPFLFKVLSIEKVLSIQAHPDKELGKKLHMEDPKNYPDDNHKPEMAVAITEFEGFCGFKPLEEIADELETIPEFRDVVGDEVANEFI 180          
BLAST of FC877903 vs. ExPASy Swiss-Prot
Match: MPI_PICAN (Mannose-6-phosphate isomerase OS=Pichia angusta GN=PMI40 PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 7.337e-34
Identity = 82/196 (41.84%), Postives = 109/196 (55.61%), Query Frame = 3
Query:  243 AARRLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDID--KPYAEFWMGTHESGPSFLXXXXXXXXXXXXXXXXXXXXXXCGEIVSLKSWILKNPN-VLGDKVLHRWGCD--LPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEVLCSFISLQELKSVLQNVPEIVELVGSE 815
            +A +L R+    Q YDWG+ GS S V++   LN  +   I+  KPYAE WMGTH S P+                          +   L+  +   P  +LG  ++ ++G    +PFLFKVLS+ K LSIQAHPDK LA+ LH   P  Y DDNHKPEMA+AIT+FE  C F  L E+ ++LQ +PE  ELVG +
Sbjct:    3 SAPKLFRVIGGAQNYDWGKLGSTSAVARFAKLNDPENVSIEEEKPYAELWMGTHPSVPTV----------------------SAQDRTPLRDLVRAAPEEMLGQDIIDKFGSKEGIPFLFKVLSIRKVLSIQAHPDKALARQLHASDPKHYPDDNHKPEMAVAITDFEAFCGFKPLAEIDALLQKIPEFRELVGDD 176          
BLAST of FC877903 vs. ExPASy Swiss-Prot
Match: MPI_MOUSE (Mannose-6-phosphate isomerase OS=Mus musculus GN=Mpi PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 7.337e-34
Identity = 81/192 (42.19%), Postives = 109/192 (56.77%), Query Frame = 3
Query:  243 AARRLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSG-KRTDIDKPYAEFWMGTHESGPSFLXXXXXXXXXXXXXXXXXXXXXXCGEIVSLKSWILKNPNVLGDKVLHRWGCDLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEVLCSFISLQELKSVLQNVPEIVELVGSE 815
            A+ R+  L+C VQ+Y WG+ GS S V+ L   +    +   DKPYAE WMGTH  G + +                           +L  WI +NP+ LG KV + +   LPFLFKVLSV  ALSIQAHP+KELA+ LH   P  Y D NHKPEMA+A+T F+ LC F  ++E+ + ++ VPE   L+G +
Sbjct:    2 ASPRVFPLSCVVQQYAWGKVGSKSEVACLLASSDPLAQISEDKPYAELWMGTHPRGDAKILDNRISQK-------------------TLGQWIAENPDCLGSKVKNTFNGKLPFLFKVLSVDTALSIQAHPNKELAEKLHLQAPEHYPDANHKPEMAIALTSFQGLCGFRPVEEIVTFMKKVPEFQLLIGDD 174          
BLAST of FC877903 vs. ExPASy Swiss-Prot
Match: MPI_MACFA (Mannose-6-phosphate isomerase OS=Macaca fascicularis GN=MPI PE=2 SV=3)

HSP 1 Score: 144.436 bits (363), Expect = 7.337e-34
Identity = 84/198 (42.42%), Postives = 112/198 (56.57%), Query Frame = 3
Query:  243 AARRLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDI--DKPYAEFWMGTHESGPSFLXXXXXXXXXXXXXXXXXXXXXXCGEIVSLKSWILKNPNVLGDKVLHRWGCDLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEVLCSFISLQELKSVLQNVPEIVELVGSEEANRV 830
            AA R+  L+C+VQ+Y WG+ G +S V++L   +S     I  DKPYAE WMGTH  G + +                           +L  WI +N + LG KV   +  +LPFLFKVLSV   LSIQAHP+KELA+ LH   P  Y D NHKPEMA+A+T F+ LC F  ++E+ + L+ VPE   L+G E A  +
Sbjct:    2 AAPRVFPLSCAVQQYAWGKMGYNSEVARLLA-SSDPLAQIAEDKPYAELWMGTHPRGDAKIFDNGISQK-------------------TLGQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHL 179          
BLAST of FC877903 vs. ExPASy Swiss-Prot
Match: MPI_CANAL (Mannose-6-phosphate isomerase OS=Candida albicans GN=PMI1 PE=1 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 1.635e-33
Identity = 82/196 (41.84%), Postives = 107/196 (54.59%), Query Frame = 3
Query:  243 AARRLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDID--KPYAEFWMGTHESGPSFLXXXXXXXXXXXXXXXXXXXXXXCGEIVSLKSWILKNPN-VLGDKVLHRWGC--DLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEVLCSFISLQELKSVLQNVPEIVELVGSE 815
            ++ +L R+ C  Q YDWG+ GS S V++    NS     ID  KPYAE WMGTH S PS                             +L+  +   P   LG+ ++ ++G   +LPFLFKVLS+ K LSIQAHPDK+L   LH   P  Y DDNHKPEMA+A+T+FE  C F  L +L   L  VPE+ E++G E
Sbjct:    2 SSEKLFRIQCGYQNYDWGKIGSSSAVAQFVH-NSDPSITIDETKPYAELWMGTHPSVPSKAIDLNNQ---------------------TLRDLVTAKPQEYLGESIITKFGSSKELPFLFKVLSIEKVLSIQAHPDKKLGAQLHAADPKNYPDDNHKPEMAIAVTDFEGFCGFKPLDQLAKTLATVPELNEIIGQE 175          
The following BLAST results are available for this feature:
BLAST of FC877903 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
MPI_SCHPO4.910e-3844.39Mannose-6-phosphate isomerase OS=Schizosaccharomyc... [more]
MPI_ECHMU2.281e-3545.21Probable mannose-6-phosphate isomerase OS=Echinoco... [more]
MPI_PANTR8.667e-3542.93Mannose-6-phosphate isomerase OS=Pan troglodytes G... [more]
MPI_HUMAN8.667e-3542.93Mannose-6-phosphate isomerase OS=Homo sapiens GN=M... [more]
MPI_YEAST1.931e-3441.79Mannose-6-phosphate isomerase OS=Saccharomyces cer... [more]
MPI_CANGA3.293e-3443.22Mannose-6-phosphate isomerase OS=Candida glabrata ... [more]
MPI_PICAN7.337e-3441.84Mannose-6-phosphate isomerase OS=Pichia angusta GN... [more]
MPI_MOUSE7.337e-3442.19Mannose-6-phosphate isomerase OS=Mus musculus GN=M... [more]
MPI_MACFA7.337e-3442.42Mannose-6-phosphate isomerase OS=Macaca fascicular... [more]
MPI_CANAL1.635e-3341.84Mannose-6-phosphate isomerase OS=Candida albicans ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA27DH11RM1 IVIA1 Citrus clementina cDNA clone IC0AAA27DH11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877903 ID=FC877903|Name=FC877903|organism=Citrus clementina|type=EST|length=844bp
AAAAAGGAAACTGTACAGTGAGTCAGAGTCATAATAAGCATAGCCCACTT
CGTCTTCACTCAATCTCTCGAATCTCTCTCTTTCAACACGCTGTTTCCCT
CTCTCTTGTTACCCTTTCAAACTCTTTAAAAACCAGCAATGCCACCCCAT
TCTAGCCATTACCCATTTACCCATACACTCTTTTAGGACTGCCCGTCTGC
TCATTTCTTCGAAAATTCAGTACCATGGACGCTGATTCGAAGGCTGCAAG
GAGGCTGCTGAGGCTGACGTGTTCCGTCCAGAAATACGATTGGGGCCGAA
CCGGTTCTGACTCCCTCGTTTCCAAGCTGTACGGGTTGAACTCTGGGAAG
AGGACTGATATCGACAAGCCTTATGCCGAGTTCTGGATGGGAACTCACGA
GTCTGGGCCCTCGTTTCTGGCGAAGAAGGGCGGTGCTGGTGGCGTTGCTG
GCGCAGTAGTAAACGGGTCGTCGGCGAATGGTGGGTGTGGTGAGATTGTC
AGTTTGAAATCATGGATATTGAAGAATCCTAATGTGCTTGGTGATAAGGT
TTTACACCGTTGGGGCTGTGATCTCCCTTTCTTGTTCAAGGTACTTTCAG
TTGCGAAAGCATTGTCAATACAGGCTCATCCAGATAAGGAGTTGGCAAAG
ACACTGCACAAATTACTGCCAAATGTATATAAGGATGACAATCACAAGCC
TGAGATGGCCTTGGCAATAACAGAGTTCGAGGTCCTTTGTAGCTTTATCA
GTCTTCAGGAGCTCAAGAGTGTGCTGCAAAACGTTCCTGAGATTGTGGAA
CTTGTTGGCAGCGAGGAAGCAAACCGAGTTTTGCATGTTGAAAT
back to top