FC878047
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FC878047 vs. ExPASy Swiss-Prot
Match: KGUA_THEEB (Guanylate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=gmk PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 5.138e-11 Identity = 37/65 (56.92%), Postives = 44/65 (67.69%), Query Frame = 3 Query: 645 PPPNPLIIVISGPSGVGKDALIKKLRESRDSLRFVVTATSRPMRPGEENGKDYYFVSKEEF*TMI 839 P P LI VI+GPSGVGK L+++LR+ L V+AT+RP RP E G DYYFVS EEF MI Sbjct: 6 PQPGQLI-VITGPSGVGKGTLLRQLRQRHPELALSVSATTRPPRPTEVAGVDYYFVSVEEFKAMI 69
BLAST of FC878047 vs. ExPASy Swiss-Prot
Match: KGUA_LACPL (Guanylate kinase OS=Lactobacillus plantarum GN=gmk PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 5.138e-11 Identity = 33/57 (57.89%), Postives = 46/57 (80.70%), Query Frame = 3 Query: 660 LIIVISGPSGVGKDALIKKLRESRDS-LRFVVTATSRPMRPGEENGKDYYFVSKEEF 827 ++IV+SGPSGVGK + K++ +S D+ ++ V+ T+R MRPGE +GKDYYFVSKEEF Sbjct: 6 MLIVLSGPSGVGKGTVRKEIFDSDDNDFQYSVSMTTRQMRPGEVDGKDYYFVSKEEF 62
BLAST of FC878047 vs. ExPASy Swiss-Prot
Match: KGUA_SYMTH (Guanylate kinase OS=Symbiobacterium thermophilum GN=gmk PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 8.764e-11 Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 3 Query: 651 PNPLIIVISGPSGVGKDALIKKLRESRDSLRFVVTATSRPMRPGEENGKDYYFVSKEEF 827 P L+IV++GPS VGK + + L +RF V+ T+RP RPGE +G +YYF+SKEEF Sbjct: 5 PKGLLIVVTGPSAVGKGTICRALLAETPGIRFSVSCTTRPKRPGEVDGVEYYFISKEEF 63 The following BLAST results are available for this feature:
BLAST of FC878047 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC878047 ID=FC878047; Name=FC878047; organism=Citrus clementina; type=EST; length=841bpback to top |