FC920176

Overview
NameFC920176
Unique NameFC920176
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length682
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15502 contig Ccv1_Contig15502:3..684. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920176 vs. ExPASy Swiss-Prot
Match: COMT1_PRUDU (Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.471e-44
Identity = 99/194 (51.03%), Postives = 133/194 (68.56%), Query Frame = 1
Query:  109 MSSFHDQLMKPP--NDEEDFMLIMELAHSSLLPMTMKAIIELGVLEILAKASPSQ-LSSSEIASQLPTNNQEASTVLDRMLRLLASYSFLTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAREKVSVDPWYHLKDCLLEGTLPFMKAHNTKNPFEYAMKDARRRNLFKIIMSNHTALVMKKILK 681
            M S  +  M P   +DEE  +  M+LA +S+LPM +KA IEL +LEI+AKA P   LS ++IASQLPT N +A  +LDRMLRLLASYS LTY+L T  DG V  +YGL  VC++L  NE+GVS+AP+ L+ ++KV ++ WYHLKD +LEG +PF KA+     FEY   D R   +F   M++H+ + MKKIL+
Sbjct:    1 MGSTGETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGVFLSPTDIASQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLADGKVERLYGLGPVCKFLTKNEEGVSIAPLCLMNQDKVLLESWYHLKDAVLEGGIPFNKAYG-MTAFEYHGTDPRFNKVFNRGMADHSTITMKKILE 193          
BLAST of FC920176 vs. ExPASy Swiss-Prot
Match: COMT1_ROSCH (Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.391e-44
Identity = 98/194 (50.52%), Postives = 132/194 (68.04%), Query Frame = 1
Query:  109 MSSFHDQLMKPP--NDEEDFMLIMELAHSSLLPMTMKAIIELGVLEILAKASPSQ-LSSSEIASQLPTNNQEASTVLDRMLRLLASYSFLTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAREKVSVDPWYHLKDCLLEGTLPFMKAHNTKNPFEYAMKDARRRNLFKIIMSNHTALVMKKILK 681
            M S  +  M P   +DEE  +  M+LA +S+LPM +KA IEL +LEI+AKA P   LS +++ASQLPT N EA  +LDRMLRLLASYS LTY+L T  DG V  +YGL  VC++L  NEDGVS+A + L+ ++KV V+ WYHLKD +L+G +PF KA+     F+Y   D R   +F   M++H+ + MKKIL+
Sbjct:    1 MGSTGETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPNDLASQLPTKNPEAPVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSIAALCLMNQDKVLVESWYHLKDAVLDGGIPFNKAYG-MTAFDYHGTDPRFNKVFNKGMADHSTITMKKILE 193          
BLAST of FC920176 vs. ExPASy Swiss-Prot
Match: COMT1_POPKI (Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.356e-42
Identity = 97/194 (50.00%), Postives = 131/194 (67.53%), Query Frame = 1
Query:  109 MSSFHDQLMKPP--NDEEDFMLIMELAHSSLLPMTMKAIIELGVLEILAKASPSQ-LSSSEIASQLPTNNQEASTVLDRMLRLLASYSFLTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAREKVSVDPWYHLKDCLLEGTLPFMKAHNTKNPFEYAMKDARRRNLFKIIMSNHTALVMKKILK 681
            M S  +  M P   +DEE  +  M+LA +S+LPM +K  IEL +LEI+AKA P   LS+SEIAS LPT N +A  +LDR+LRLLASYS LT +L    DG V  +YGLA VC++L  NEDGVS++P+ L+ ++KV ++ WY+LKD +LEG +PF KA+     FEY   D R   +F   MS+H+ + MKKIL+
Sbjct:    1 MGSTGETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEIASHLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQDKVLMESWYYLKDAILEGGIPFNKAYG-MTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILE 193          
BLAST of FC920176 vs. ExPASy Swiss-Prot
Match: IEMT_CLABR ((Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 3.021e-42
Identity = 93/181 (51.38%), Postives = 126/181 (69.61%), Query Frame = 1
Query:  145 NDEEDFMLIMELAHSSLLPMTMKAIIELGVLEILAKASPSQ--LSSSEIASQLPTNNQEASTVLDRMLRLLASYSFLTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAREKVSVDPWYHLKDCLLEGTLPFMKAHNTKNPFEYAMKDARRRNLFKIIMSNHTALVMKKILK 681
            +DEE  +  M+LA +++LPM +KA IEL VLEI+AK+ P    +S +EIA+QLPT N EA  +LDR+LRLLASYS +TY L     G V  +YGLA VC++L  NEDGVSLAP  L A +KV ++PW++LKD +LEG +PF KA+   N F+Y   D R   +F   MS+++ + MKKIL+
Sbjct:   17 SDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKFLTKNEDGVSLAPFLLTATDKVLLEPWFYLKDAILEGGIPFNKAYG-MNEFDYHGTDHRFNKVFNKGMSSNSTITMKKILE 196          
BLAST of FC920176 vs. ExPASy Swiss-Prot
Match: COMT1_POPTM (Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.021e-42
Identity = 96/194 (49.48%), Postives = 131/194 (67.53%), Query Frame = 1
Query:  109 MSSFHDQLMKPP--NDEEDFMLIMELAHSSLLPMTMKAIIELGVLEILAKASPSQ-LSSSEIASQLPTNNQEASTVLDRMLRLLASYSFLTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAREKVSVDPWYHLKDCLLEGTLPFMKAHNTKNPFEYAMKDARRRNLFKIIMSNHTALVMKKILK 681
            M S  +  M P   +DEE  +  M+LA +S+LPM +K  IEL +LEI+AKA P   LS+SEIAS LPT N +A  +LDR+LRLLASYS LT +L    DG V  +YGLA VC++L  NEDGVS++P+ L+ ++KV ++ WY+LKD +L+G +PF KA+     FEY   D R   +F   MS+H+ + MKKIL+
Sbjct:    1 MGSTGETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEIASHLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQDKVLMESWYYLKDAILDGGIPFNKAYG-MTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILE 193          
BLAST of FC920176 vs. ExPASy Swiss-Prot
Match: COMT1_MEDSA (Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.148e-41
Identity = 90/180 (50.00%), Postives = 128/180 (71.11%), Query Frame = 1
Query:  145 NDEEDFMLIMELAHSSLLPMTMKAIIELGVLEILAKASP-SQLSSSEIASQLPTNNQEASTVLDRMLRLLASYSFLTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAREKVSVDPWYHLKDCLLEGTLPFMKAHNTKNPFEYAMKDARRRNLFKIIMSNHTALVMKKILK 681
            +DEE  +  M+LA +S+LPM +K+ +EL +LEI+AKA P +Q+S  EIASQLPT N +A  +LDRMLRLLA Y  LT ++ T +DG V  +YGLA+V +YL+ NEDGVS++ + L+ ++KV ++ WYHLKD +L+G +PF KA+     FEY   D R   +F   MS+H+ + MKKIL+
Sbjct:   15 SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEIASQLPTTNPDAPVMLDRMLRLLACYIILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQDKVLMESWYHLKDAVLDGGIPFNKAYG-MTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILE 193          
BLAST of FC920176 vs. ExPASy Swiss-Prot
Match: COMT1_EUCGU (Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.958e-41
Identity = 91/180 (50.56%), Postives = 124/180 (68.89%), Query Frame = 1
Query:  145 NDEEDFMLIMELAHSSLLPMTMKAIIELGVLEILAKASPSQ-LSSSEIASQLPTNNQEASTVLDRMLRLLASYSFLTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAREKVSVDPWYHLKDCLLEGTLPFMKAHNTKNPFEYAMKDARRRNLFKIIMSNHTALVMKKILK 681
            +DEE  +  M+LA +S+LPM +KA IEL +LEI+AKA P   LS  E+A+QLPT N EA  +LDR+ RLLASYS LT  L    DG V  +YGLA VC++L+ NEDGVS+A + L+ ++K+ ++ WY+LKD +LEG +PF KA+     FEY   D R   +F   MS+H+ + MKKIL+
Sbjct:   16 SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPGEVAAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRNLPDGKVERLYGLAPVCKFLVKNEDGVSIAALNLMNQDKILMESWYYLKDAVLEGGIPFNKAYG-MTAFEYHGTDPRFNKIFNRGMSDHSTITMKKILE 194          
BLAST of FC920176 vs. ExPASy Swiss-Prot
Match: COMT1_CAPCH (Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.557e-41
Identity = 93/192 (48.44%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  109 MSSFHDQLMKPPNDEEDFMLIMELAHSSLLPMTMKAIIELGVLEILAKASPSQ-LSSSEIASQLPTNNQEASTVLDRMLRLLASYSFLTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAREKVSVDPWYHLKDCLLEGTLPFMKAHNTKNPFEYAMKDARRRNLFKIIMSNHTALVMKKILK 681
            M S +  L +   ++E F+  M+LA +S+LPM +KA +EL +LEI+AK+ P   +S SE+A+QLPT N EA  +LDRM RLLA+YS L   L T  DG V  +Y LA VC++L  N DGVS+API L+ ++KV ++ WYHL D +L+G +PF KA+     FEY   D R   +F   MS+HT L MKKIL+
Sbjct:    1 MGSINQSLTQ--TEDEAFVFAMQLASASVLPMVLKATVELDLLEIMAKSGPGAFISPSELAAQLPTKNPEAPVMLDRMFRLLATYSVLNCTLRTLPDGRVERLYSLAPVCKFLTKNGDGVSIAPILLMNQDKVLMESWYHLTDAVLDGGVPFNKAYG-MTTFEYHGTDPRFNKVFNCGMSDHTTLSMKKILE 189          
BLAST of FC920176 vs. ExPASy Swiss-Prot
Match: COMT1_CLABR (Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.362e-41
Identity = 91/183 (49.73%), Postives = 127/183 (69.40%), Query Frame = 1
Query:  145 NDEEDFMLIMELAHSSLLPMTMKAIIELGVLEILAKASP----SQLSSSEIASQLPTNNQEASTVLDRMLRLLASYSFLTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAREKVSVDPWYHLKDCLLEGTLPFMKAHNTKNPFEYAMKDARRRNLFKIIMSNHTALVMKKILK 681
            +DEE  +  M+LA +S+LPM +KA IEL VLEI+AK+ P    + +S +EIA+QLPT N +A  +LDR+LRLLASYS +T +L    DG V  +YGLA VC++L  NEDGVSLAP+ L+ ++KV ++ WY+LKD +L+G +PF KA+     FEY   D R   +F   MS+H+ + MKKI +
Sbjct:   17 SDEEANLFAMQLASASVLPMVLKAAIELDVLEIMAKSIPHGSGAYISPAEIAAQLPTTNPDAPVMLDRVLRLLASYSVVTCSLRELPDGKVERLYGLAPVCKFLTKNEDGVSLAPLCLMNQDKVLMESWYYLKDAILDGGIPFNKAYG-MTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIFE 198          
BLAST of FC920176 vs. ExPASy Swiss-Prot
Match: COMT1_COFCA (Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.697e-41
Identity = 89/179 (49.72%), Postives = 124/179 (69.27%), Query Frame = 1
Query:  148 DEEDFMLIMELAHSSLLPMTMKAIIELGVLEILAKASP-SQLSSSEIASQLPTNNQEASTVLDRMLRLLASYSFLTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAREKVSVDPWYHLKDCLLEGTLPFMKAHNTKNPFEYAMKDARRRNLFKIIMSNHTALVMKKILK 681
            +EE  +  M LA +S+LPM +K+ IEL +LE++AKA P + +S SE+A+QLPT+N EA  +LDR+LRLLA+YS L   L    DG V  +YGLA VC++L  N DGVS+AP+ L+ ++KV ++ WYHLKD +L+G +PF KA+     FEY   D R   +F   MSNH+ + MKKIL+
Sbjct:    3 EEEACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSELAAQLPTHNPEAPIMLDRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQDKVLMESWYHLKDAVLDGGIPFNKAYG-MTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILE 180          
The following BLAST results are available for this feature:
BLAST of FC920176 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
COMT1_PRUDU2.471e-4451.03Caffeic acid 3-O-methyltransferase OS=Prunus dulci... [more]
COMT1_ROSCH9.391e-4450.52Caffeic acid 3-O-methyltransferase OS=Rosa chinens... [more]
COMT1_POPKI1.356e-4250.00Caffeic acid 3-O-methyltransferase 1 OS=Populus ki... [more]
IEMT_CLABR3.021e-4251.38(Iso)eugenol O-methyltransferase OS=Clarkia brewer... [more]
COMT1_POPTM3.021e-4249.48Caffeic acid 3-O-methyltransferase 1 OS=Populus tr... [more]
COMT1_MEDSA1.148e-4150.00Caffeic acid 3-O-methyltransferase OS=Medicago sat... [more]
COMT1_EUCGU1.958e-4150.56Caffeic acid 3-O-methyltransferase OS=Eucalyptus g... [more]
COMT1_CAPCH2.557e-4148.44Caffeic acid 3-O-methyltransferase OS=Capsicum chi... [more]
COMT1_CLABR4.362e-4149.73Caffeic acid 3-O-methyltransferase OS=Clarkia brew... [more]
COMT1_COFCA5.697e-4149.72Caffeic acid 3-O-methyltransferase OS=Coffea canep... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005A04EF RVDevelop1 Citrus clementina cDNA clone C32005A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920176 ID=FC920176|Name=FC920176|organism=Citrus clementina|type=EST|length=682bp
ATAACTAATATATCTATACGTGTATCTATATAGTTATATACTGAGCGCTC
ATCAACATCATCCATTGCCATTTTGTTAATTTCAGCATATCCTACTCCGA
GAATTAAGATGAGTTCATTCCATGACCAACTCATGAAACCACCAAACGAT
GAGGAAGATTTCATGCTGATCATGGAGCTTGCCCACAGCTCATTACTTCC
GATGACCATGAAAGCTATCATCGAGCTTGGTGTGTTAGAGATTTTAGCTA
AAGCTAGTCCATCTCAGCTTTCTTCTTCTGAGATTGCATCTCAGCTGCCC
ACAAATAACCAAGAAGCCTCAACAGTGCTTGATCGAATGTTACGACTCCT
TGCTAGTTACTCTTTCCTAACATATAATCTTGTCACAAATAAAGATGGAA
ATGTTTGCGGAGTATATGGTTTAGCGTCCGTTTGCAGATATTTGCTTCCA
AATGAAGACGGAGTTTCTCTTGCTCCCATTTTCCTCTTAGCTCGGGAGAA
AGTTTCTGTAGATCCTTGGTACCACTTGAAAGATTGTTTATTGGAAGGGA
CCCTACCTTTTATGAAGGCACATAATACAAAAAATCCATTTGAGTATGCT
ATGAAAGATGCTAGAAGACGGAACCTCTTCAAAATCATCATGAGCAATCA
TACGGCTTTAGTTATGAAGAAAATCTTGAAAT
back to top