FC920179

Overview
NameFC920179
Unique NameFC920179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13970 contig Ccv1_Contig13970:471..1173. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920179 vs. ExPASy Swiss-Prot
Match: Y4919_ARATH (Uncharacterized zinc finger CCHC domain-containing protein At4g19190 OS=Arabidopsis thaliana GN=At4g19190 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.980e-64
Identity = 116/137 (84.67%), Postives = 124/137 (90.51%), Query Frame = 1
Query:   13 KMCFGRPLPTEEEFEILKNAPRLETGAPARVKPFGVEVRNVKCLRCGNFGHQSGDRECPLKDAIMPNEESRLKRDDPLTAIMAHVDPSEPLKWELKRQPGNFSPPRGGFKPDDPNQQIVAEDIFDEYGGFLAGDSVP 423
            K  FGR LPTEEEFE+LKNAPR+ETG P RVKPF VEVRNVKCLRCGNFGHQSGDR+CPLKDA+MPNEE RLKRDDPLTAI+AH DPSEPLKWELK++PG  SPPRGGF PDDPNQQIVAEDIFDEYGGFL G S+P
Sbjct:  171 KDVFGRALPTEEEFEVLKNAPRMETGIPGRVKPFAVEVRNVKCLRCGNFGHQSGDRDCPLKDAVMPNEELRLKRDDPLTAIIAHTDPSEPLKWELKQKPG-LSPPRGGFDPDDPNQQIVAEDIFDEYGGFLEG-SIP 305          
The following BLAST results are available for this feature:
BLAST of FC920179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y4919_ARATH2.980e-6484.67Uncharacterized zinc finger CCHC domain-containing... [more]
back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005A07EF RVDevelop1 Citrus clementina cDNA clone C32005A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920179 ID=FC920179|Name=FC920179|organism=Citrus clementina|type=EST|length=703bp
AATCAAGGCCAAAAGATGTGTTTCGGGCGACCTTTACCTACTGAAGAAGA
GTTTGAAATCCTTAAAAATGCTCCACGGCTGGAGACAGGTGCTCCTGCAA
GGGTAAAACCATTTGGTGTTGAAGTAAGAAATGTGAAATGTTTAAGATGT
GGAAATTTTGGGCATCAAAGTGGTGATCGTGAGTGTCCATTGAAGGATGC
AATAATGCCTAATGAAGAAAGTCGATTGAAAAGAGATGACCCCTTGACTG
CTATCATGGCTCACGTAGATCCTAGTGAGCCTCTCAAGTGGGAGCTGAAG
CGACAACCAGGAAATTTTAGTCCTCCTCGTGGAGGTTTTAAACCTGATGA
TCCCAATCAGCAGATAGTTGCTGAGGACATTTTTGATGAATATGGGGGGT
TTCTGGCTGGGGATAGTGTACCCGACTTGTTGAGCAGCTTGTCGGGCAAA
CGTAGAAAGAAGTCCAAAAAGAAAAGTAAACACAAAAGGCAGGCATCATC
TGATAGTGAAGAATTAAGAGTTTCTGATGACGATGGGGTGACTTCACCTT
CCGATGATGAAGGCAGGAGGTCAAAGAAGGAGAAGAACCATAAGAAGAAA
ACGAAGCGAAACTATTCCAAATCTAGTTCGTCTGATGTTTCAGAATGGAA
TACACATCGTAGAAAATCAGACACAGCACAATTATTCATCCGAAGATCTG
ATT
back to top