FC920180

Overview
NameFC920180
Unique NameFC920180
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length642
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10294 contig Ccv1_Contig10294:8..649. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI6_POPTR (Acidic endochitinase WIN6 OS=Populus trichocarpa GN=WIN6 PE=2 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 1.468e-56
Identity = 110/194 (56.70%), Postives = 129/194 (66.49%), Query Frame = 2
Query:   95 GSAGNCG---SGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGE-----CDPDDGTAGDG--GELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDP--NYPC-RGKYY-GRGPIQLTWKLHY 634
            GSA  CG      +CPGG CCS +GWCG T+D+C  GCQS C+    G+     CD  D   GDG  G L  II +  F+ LL++RND RCPA  FYTY+AFI AAK FP FGN+G++ MRKREIAAF  QT HETTGGWPDAP G YAWGYC+ +E+      YCDP  NY C  GK Y GRGPIQL+W  +Y
Sbjct:   20 GSAEQCGRQAGDALCPGGLCCSSYGWCGTTVDYCGIGCQSQCDGGGGGDGGDDGCDGGDDGGGDGDDGYLSDIIPKSKFDALLKFRNDARCPAAGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETTGGWPDAPCGPYAWGYCYLKEINC--QPYCDPSSNYQCVAGKQYCGRGPIQLSWNYNY 211          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIB_VITVI (Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 4.722e-55
Identity = 102/187 (54.55%), Postives = 126/187 (67.38%), Query Frame = 2
Query:   95 GSAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCRG--KYYGRGPIQLTWKLHY 634
            GSA  CG    G VCPGG CCS+FGWCG T D+C  GCQS C+                 G++G++I+R MF D+L++RN+  CP + FYTYDAFI AAKAFP FG +G+ T RKREIAAF AQT HETTGGW  AP G YAWGYC+ RE G+  + YC P+  +PC    KYYGRGPIQ+++  +Y
Sbjct:   18 GSAEQCGGQAGGRVCPGGACCSKFGWCGNTADYCGSGCQSQCSST---------------GDIGQLITRSMFNDMLKHRNEGSCPGKGFYTYDAFIAAAKAFPGFGTTGDTTTRKREIAAFLAQTSHETTGGWASAPDGPYAWGYCYLREQGSPGA-YCVPSAQWPCAAGRKYYGRGPIQISYNYNY 188          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.061e-54
Identity = 109/191 (57.07%), Postives = 130/191 (68.06%), Query Frame = 2
Query:   95 GSAGNCG---SGVVCPGGECCSRFGWCGLTIDHCC--DGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTG--GWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR-GK-YYGRGPIQLTWKLHY 634
            GSA  CG    G +CPGG CCS+FGWCG T D+C   +GCQS C+           G+ GD G L  +I+RE F+ +L +RND  CPAR FYTYDAFI AAK+FPAF  +G++  RKRE+AAF AQT HETTG  GW  AP G Y WGYC+NRE+  A  DYC  DPNYPC  GK Y+GRGP+QLTW  +Y
Sbjct:   19 GSAEQCGRQAGGALCPGGLCCSQFGWCGNTDDYCKKENGCQSQCS-----------GSGGDTGGLDSLITRERFDQMLLHRNDGGCPARGFYTYDAFIAAAKSFPAFATTGDDATRKREVAAFLAQTSHETTGGAGWA-APDGPYTWGYCYNRELNPA--DYCQWDPNYPCAPGKQYFGRGPMQLTWNYNY 195          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.420e-53
Identity = 99/187 (52.94%), Postives = 121/187 (64.71%), Query Frame = 2
Query:   92 GGSAGN-CG---SGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCR--GKYYGRGPIQLTWKLHY 634
            GGS G  CG    G +CPGG CCS+FGWCG T D+C  GCQS C            G +    +L  +ISR  F+ +L++RND  CPA+ FYTYDAFI AAKA+P+FGN+G+   RKREIAAF  QT HETTGGW  AP G YAWGYCF RE   ++     P +PC    +YYGRGPIQ++W  +Y
Sbjct:   23 GGSYGEQCGRQAGGALCPGGNCCSQFGWCGSTTDYCGPGCQSQCG-----------GPSPAPTDLSALISRSTFDQMLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPSTYCSATPQFPCAPGQQYYGRGPIQISWNYNY 198          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.773e-53
Identity = 109/190 (57.37%), Postives = 127/190 (66.84%), Query Frame = 2
Query:   95 GSAGNCG---SGVVCPGGECCSRFGWCGLTIDHCC-DGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTG--GWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR-GK-YYGRGPIQLTWKLHY 634
            GSA  CG    G +CPGG CCS+FGWCG T D+C   GCQS C+           G A   G L  +ISRE F  +L +RND  CPAR FYTYDAFI AA++FPAF  +G++  RKREIAAF AQT HETTG  GW  AP G YAWGYC+NRE+   SS YC  DPNYPC  GK Y+GRGP+QL+W  +Y
Sbjct:   20 GSAEQCGRQAGGALCPGGLCCSQFGWCGSTADYCTVPGCQSQCS---------GSGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSS-YCASDPNYPCAPGKQYFGRGPMQLSWNYNY 198          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI5_PHAVU (Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.742e-52
Identity = 98/187 (52.41%), Postives = 120/187 (64.17%), Query Frame = 2
Query:   92 GGSAGN-CG---SGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCR--GKYYGRGPIQLTWKLHY 634
            GGS G  CG    G +CPGG CCS+FGWCG T D+C   CQS C            G +    +L  +ISR  F+ +L++RND  CPA+ FYTYDAFI AAKA+P+FGN+G+   RKREIAAF  QT HETTGGW  AP G YAWGYCF RE   ++     P +PC    +YYGRGPIQ++W  +Y
Sbjct:   22 GGSYGEQCGRQAGGALCPGGNCCSQFGWCGSTTDYCGKDCQSQCG-----------GPSPAPTDLSALISRSTFDQVLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPSAYCSATPQFPCAPGQQYYGRGPIQISWNYNY 197          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 3.742e-52
Identity = 95/184 (51.63%), Postives = 120/184 (65.22%), Query Frame = 2
Query:   98 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRG--KYYGRGPIQLTWKLHY 634
            SA  CG+   G +CPGG CCS+FGWCG T ++C DGCQS C+           G++G GG L  +IS + F ++L++RND  C  + FYTYDAF+ AAKAFP F N G+   +KREIAAF  QT HETTGGWP AP G YAWGYCF RE   ++       +PC    +YYGRGPIQ++W  +Y
Sbjct:   19 SAEQCGTQAGGALCPGGLCCSKFGWCGSTSEYCGDGCQSQCS-----------GSSG-GGTLSSLISGDTFNNMLKHRNDNACQGKPFYTYDAFLSAAKAFPNFANKGDTATKKREIAAFLGQTSHETTGGWPTAPDGPYAWGYCFLREQNPSTYCQASSEFPCASGKQYYGRGPIQISWNYNY 190          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 204.142 bits (518), Expect = 4.887e-52
Identity = 99/187 (52.94%), Postives = 122/187 (65.24%), Query Frame = 2
Query:   98 SAGNCG---SGVVCPGGECCSRFGWCGLTIDHCCD-GCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCRG--KYYGRGPIQLTWKLHY 634
            SA  CG    G +CP G CCS FGWCG T  +C   GCQS        +C P     G  G+L  IIS   F+D+L++RND  CPAR FYTY+AFI AAK+FP FG +G+   RK+E+AAFF QT HETTGGW  AP G Y+WGYCF +E   A SDYC+P+  +PC    +YYGRGP+QL+W  +Y
Sbjct:   32 SAEQCGRQAGGALCPNGLCCSEFGWCGNTEPYCKQPGCQS--------QCTPGGTPPGPTGDLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPA-SDYCEPSATWPCASGKRYYGRGPMQLSWNYNY 209          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 8.336e-52
Identity = 105/184 (57.07%), Postives = 123/184 (66.85%), Query Frame = 2
Query:  104 GNCGSGVVCPGGECCSRFGWCGLTIDHCC-DGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTG--GWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR-GK-YYGRGPIQLTWKLHY 634
            G    G +CPGG CCS+FGWCG T D+C   GCQS C+           G A   G L  +ISRE F  +L +RND  CPAR FYTYDAFI AA++FPAF  +G++  RKREIAAF AQT HETTG  GW  AP G YAWGYC+NRE+   SS YC  DPNYPC  GK Y+GRGP+QL+W  +Y
Sbjct:    4 GRQAGGALCPGGLCCSQFGWCGSTADYCTVPGCQSQCS---------GSGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSS-YCASDPNYPCAPGKQYFGRGPMQLSWNYNY 176          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 8.336e-52
Identity = 103/187 (55.08%), Postives = 124/187 (66.31%), Query Frame = 2
Query:   98 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            SA  CGS   G  CP G CCS+FGWCG T D+C  G CQS C     G   P   T   GG+LG IIS  MF+ +L++RND  C  + FY+Y+AFI AA++FP FG SG+ T RKREIAAFFAQT HETTGGW  AP G YAWGYC+ RE G +  DYC P+  +PC    KY+GRGPIQ++   +Y
Sbjct:   22 SAEQCGSQAGGARCPSGLCCSKFGWCGNTNDYCGPGNCQSQCP----GGPTPTPPTPPGGGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQG-SPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNY 203          
The following BLAST results are available for this feature:
BLAST of FC920180 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI6_POPTR1.468e-5656.70Acidic endochitinase WIN6 OS=Populus trichocarpa G... [more]
CHIB_VITVI4.722e-5554.55Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE... [more]
CHI1_THECC3.061e-5457.07Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHIT_PHAVU4.420e-5352.94Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]
CHI1_GOSHI5.773e-5357.37Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI5_PHAVU3.742e-5252.41Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1[more]
CHI2_PEA3.742e-5251.63Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHIB_ARATH4.887e-5252.94Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI2_GOSHI8.336e-5257.07Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHI1_TOBAC8.336e-5255.08Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005A08EF RVDevelop1 Citrus clementina cDNA clone C32005A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920180 ID=FC920180|Name=FC920180|organism=Citrus clementina|type=EST|length=642bp
AGCAGAGGATAATTGATCTCATAACTGTTGCTTTCAAATGAGGCTTATTG
CGTCCTTACTAATTTTCTCTCTGGTTTTATCTTTTGTACTAGGAGGCTCA
GCAGGGAACTGTGGAAGCGGCGTTGTGTGCCCAGGAGGGGAGTGTTGTAG
TCGATTTGGTTGGTGTGGCCTAACAATAGACCACTGTTGTGACGGCTGCC
AAAGTAACTGTAATCAGGTTGTTTGCGGTGAATGTGATCCCGACGACGGG
ACGGCTGGTGATGGCGGTGAACTGGGCAAGATCATCTCAAGGGAGATGTT
TGAAGACTTGCTTGAGTATAGAAATGATAAACGATGCCCTGCCAGATGCT
TCTACACTTATGATGCTTTTATAGAGGCAGCCAAAGCTTTTCCAGCCTTT
GGTAACTCTGGAAATGAAACCATGCGTAAAAGAGAAATTGCTGCCTTTTT
TGCCCAAACTGGCCATGAAACTACTGGGGGATGGCCCGATGCACCTGGTG
GCGAATATGCTTGGGGATATTGCTTTAATAGGGAAGTTGGCGCTGCGTCG
TCCGACTACTGTGATCCTAACTATCCATGTCGAGGGAAGTACTATGGCCG
AGGTCCAATTCAACTCACTTGGAAATTACATTACTTACGGTG
back to top