FC920182

Overview
NameFC920182
Unique NameFC920182
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length512
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:4..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920182 vs. ExPASy Swiss-Prot
Match: G3PC_MAGLI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Magnolia liliiflora GN=GAPC PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 4.020e-65
Identity = 121/144 (84.03%), Postives = 124/144 (86.11%), Query Frame = 3
Query:   81 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 512
            K+KIGINGFGRIGRLVARV LQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKD KTLLFGEKPVTVFGVRNPEEIPW ETGAE+VVESTGVFT               VIISAPSKDAPMFVVGVNEHEYK  +
Sbjct:    5 KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDSKTLLFGEKPVTVFGVRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKSNI 148          
BLAST of FC920182 vs. ExPASy Swiss-Prot
Match: G3P_ATRNU (Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 1.170e-64
Identity = 120/146 (82.19%), Postives = 125/146 (85.62%), Query Frame = 3
Query:   75 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 512
            M KVKIGINGFGRIGRLVARVILQ DD ELVA+NDPFITTDYMTYMFKYDSVHGQWKHHELKVKD+KTLLFGE+PVTVFG RNPEEIPW +TGA+YVVESTGVFT               VIISAPSKDAPMFVVGVNEHEYK EL
Sbjct:    1 MAKVKIGINGFGRIGRLVARVILQSDDCELVAINDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGERPVTVFGNRNPEEIPWGQTGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKSEL 146          
BLAST of FC920182 vs. ExPASy Swiss-Prot
Match: G3PC_ARATH (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Arabidopsis thaliana GN=GAPC PE=2 SV=2)

HSP 1 Score: 243.047 bits (619), Expect = 5.805e-64
Identity = 115/144 (79.86%), Postives = 127/144 (88.19%), Query Frame = 3
Query:   81 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 512
            K++IGINGFGRIGRLVARV+LQRDDVELVAVNDPFITT+YMTYMFKYDSVHGQWKH+ELK+KD+KTLLFGEKPVTVFG+RNPE+IPWAE GA+YVVESTGVFT               V+ISAPSKDAPMFVVGVNEHEYK +L
Sbjct:    5 KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDL 148          
BLAST of FC920182 vs. ExPASy Swiss-Prot
Match: G3PC_PETHY (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.881e-63
Identity = 117/146 (80.14%), Postives = 123/146 (84.25%), Query Frame = 3
Query:   75 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 512
            M K+KIGINGFGRIGRLVARV LQRDDVELVAVNDPFI+ +YMTYMFKYDSVHGQWKHHELK KDDKTLLFGEKPVTVFG+RNPEEIPW E GA+YVVESTGVFT               VIISAPSKDAPMFVVGVNE EYK +L
Sbjct:    1 MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDSVHGQWKHHELKAKDDKTLLFGEKPVTVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKEYKSDL 146          
BLAST of FC920182 vs. ExPASy Swiss-Prot
Match: G3PC_SINAL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2)

HSP 1 Score: 239.965 bits (611), Expect = 4.914e-63
Identity = 115/144 (79.86%), Postives = 126/144 (87.50%), Query Frame = 3
Query:   81 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 512
            K+KIGINGFGRIGRLVARVILQR+DVELVAVNDPFITT+YMTYMFKYDSVHGQWKH+ELKVKD+KTLLFGEKPVTVFG+RNPE+IPW E GA++VVESTGVFT               V+ISAPSKDAPMFVVGVNEHEYK +L
Sbjct:    5 KIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDL 148          
BLAST of FC920182 vs. ExPASy Swiss-Prot
Match: G3PC_DIACA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 4.914e-63
Identity = 117/146 (80.14%), Postives = 124/146 (84.93%), Query Frame = 3
Query:   75 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 512
            M  +KIGINGFGRIGRLVARVILQR+D ELVAVNDPFITT+YMTYMFKYDSVHGQWKHH++KVKD+KTLLFGEK VTVFG RNPEEIPW  TGA+YVVESTGVFT               VIISAPSKDAPMFVVGVNEHEYKPEL
Sbjct:    1 MAPIKIGINGFGRIGRLVARVILQREDCELVAVNDPFITTEYMTYMFKYDSVHGQWKHHDIKVKDEKTLLFGEKAVTVFGNRNPEEIPWGGTGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKPEL 146          
BLAST of FC920182 vs. ExPASy Swiss-Prot
Match: G3PC_RANAC (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ranunculus acris GN=GAPC PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 4.160e-62
Identity = 115/145 (79.31%), Postives = 122/145 (84.14%), Query Frame = 3
Query:   78 GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 512
            GK+KIGINGFGRIGRLVARV L RDDVELVAVNDPFITTDYMTYMFKYD+VHGQWKHHELKVKD+KTLLFGEKPVTVFG RNPEEIPW ETGAE+VVESTGVFT               V+ISAPS DAPMFVVGVN  EYK ++
Sbjct:    3 GKIKIGINGFGRIGRLVARVALARDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHELKVKDEKTLLFGEKPVTVFGCRNPEEIPWGETGAEFVVESTGVFTTKEKASAHLKGGAKKVVISAPSADAPMFVVGVNHTEYKSDI 147          
BLAST of FC920182 vs. ExPASy Swiss-Prot
Match: G3PC_GINBI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 7.096e-62
Identity = 114/145 (78.62%), Postives = 121/145 (83.45%), Query Frame = 3
Query:   78 GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 512
            GK+KIGINGFGRIGRLVARV L RDD+ELVAVNDPFI+TDYMTYMFKYDSVHGQWK HE+KVKD  TLLFGEK VTVFG RNPEEIPW ETG EYVVESTGVFT               V+I+APSKDAPMFVVGVNEHEYKP+L
Sbjct:    5 GKIKIGINGFGRIGRLVARVALLRDDIELVAVNDPFISTDYMTYMFKYDSVHGQWKKHEVKVKDSNTLLFGEKAVTVFGCRNPEEIPWGETGVEYVVESTGVFTDKEKAAAHIKGGAKKVVITAPSKDAPMFVVGVNEHEYKPDL 149          
BLAST of FC920182 vs. ExPASy Swiss-Prot
Match: G3PC_CRAPL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 4.600e-61
Identity = 115/146 (78.77%), Postives = 122/146 (83.56%), Query Frame = 3
Query:   75 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 512
            M KVKIGINGFGRIGRLVARV L RDDVELVAVNDPFIT DYM YMFKYD+VHGQ+KHHELKVKD+KTLLFG+KPV VFG+RNPEEIPWAETGAEYVVESTGVFT               VIISAPSKDAPMFVVGVNE  Y P++
Sbjct:    1 MAKVKIGINGFGRIGRLVARVALVRDDVELVAVNDPFITVDYMAYMFKYDTVHGQYKHHELKVKDEKTLLFGDKPVAVFGLRNPEEIPWAETGAEYVVESTGVFTEKEKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDI 146          
BLAST of FC920182 vs. ExPASy Swiss-Prot
Match: G3PC_ANTMA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.025e-60
Identity = 116/146 (79.45%), Postives = 121/146 (82.88%), Query Frame = 3
Query:   75 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 512
            M  +KIGINGFGRIGRLVARV LQRDDVELVAVNDPFI+TDYMTYMFKYDSVHG WKHHELKVKD+KTLLFGEKPV VFG RNPEEIP A TGAEY+VESTGVFT               VIISAPSKDAPMFVVGVNE EYK +L
Sbjct:    1 MAPIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGAWKHHELKVKDEKTLLFGEKPVVVFGRRNPEEIPRASTGAEYIVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKEYKSDL 146          
The following BLAST results are available for this feature:
BLAST of FC920182 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 308
Match NameE-valueIdentityDescription
G3PC_MAGLI4.020e-6584.03Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P_ATRNU1.170e-6482.19Glyceraldehyde-3-phosphate dehydrogenase OS=Atripl... [more]
G3PC_ARATH5.805e-6479.86Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PETHY2.881e-6380.14Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_SINAL4.914e-6379.86Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_DIACA4.914e-6380.14Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_RANAC4.160e-6279.31Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_GINBI7.096e-6278.62Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_CRAPL4.600e-6178.77Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ANTMA1.025e-6079.45Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005A10EF RVDevelop1 Citrus clementina cDNA clone C32005A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920182 ID=FC920182|Name=FC920182|organism=Citrus clementina|type=EST|length=512bp
ACACGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACC
GCTCAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAA
CGGATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGG
ACGATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTAC
ATGACATACATGTTTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCA
TGAATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTG
TCACTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACT
GGAGCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAA
GGCTGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCC
CCAGCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTAC
AAACCAGAGCTC
back to top