FC920184

Overview
NameFC920184
Unique NameFC920184
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length685
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:16..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: AUHM_MOUSE (Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Auh PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.344e-26
Identity = 60/134 (44.78%), Postives = 82/134 (61.19%), Query Frame = 1
Query:  283 KNALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            KNAL  ++L+ L  A + +  D     ++IRS VP +FCAGADLKER +M  SE+  +V+ +RS  + +  LP+PTIA ID             CD+R+   +A +GL ET LAIIPG GGTQRL +  G S+A
Sbjct:   75 KNALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMHSSEVGPFVSKIRSVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLA 208          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: AUHM_HUMAN (Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=AUH PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.222e-26
Identity = 58/134 (43.28%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  283 KNALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            KN+L  ++++ L  A + +  D     ++IRS VP +FCAGADLKER +MS SE+  +V+ +R+  + +  LP+PTIA ID             CD+R+   +A +GL ET LAIIPG GGTQRL +  G S+A
Sbjct:  100 KNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLA 233          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: YNGF_BACSU (Putative enoyl-CoA hydratase/isomerase yngF OS=Bacillus subtilis GN=yngF PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.541e-25
Identity = 61/133 (45.86%), Postives = 83/133 (62.41%), Query Frame = 1
Query:  286 NALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            NAL  +MLR L+   + I  +S+   V++  +  K FCAGADLKER ++   ++   V+ ++ T + L+ALP P IA I+             CDLRI  EAA+LGLPETGLAIIPGAGGTQRL ++ G+  A
Sbjct:   26 NALSAEMLRNLQMIIQEIEFNSNIRCVILTGTGEKAFCAGADLKERIKLKEDQVLESVSLIQRTAALLDALPQPVIAAINGSALGGGLELALACDLRIATEAAVLGLPETGLAIIPGAGGTQRLPRLIGRGKA 158          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: AUHM_DICDI (Methylglutaconyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=auh PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.680e-24
Identity = 59/130 (45.38%), Postives = 81/130 (62.31%), Query Frame = 1
Query:  283 KNALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXG 672
            KNALG +++   +     +       VV++RS V  VFC+GADLKER  MS  E   +V++LRS+F+ LE L +PTIA I+             CD R+  +++ +GLPETGLAIIPGAGGTQRL ++ G
Sbjct:   68 KNALGKNLMNQFRSHLNELRFCPDTRVVIVRSLVDGVFCSGADLKERALMSQVEASQFVHSLRSSFTELETLQMPTIAAIEGVAVGGGTEMVLACDFRVASKSSKMGLPETGLAIIPGAGGTQRLPRLIG 197          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: ECHD2_MOUSE (Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus GN=Echdc2 PE=2 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 3.743e-24
Identity = 59/134 (44.03%), Postives = 78/134 (58.21%), Query Frame = 1
Query:  283 KNALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            +NALG   +  L  A   + ED    V++ RS+V  VFCAGADLKER QMS  E+  +V  LR   S + A P+PTIA +D             CDLRI   +A++GL ET   ++PGAGGTQRL +  G ++A
Sbjct:   57 RNALGNVFVSELLEALAQLREDQQVRVLLFRSAVKGVFCAGADLKEREQMSDVEVGTFVQRLRGLMSEIAAFPVPTIAAMDGFALGGGLELALACDLRIAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALA 190          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: ECHD2_BOVIN (Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.857e-23
Identity = 57/134 (42.54%), Postives = 77/134 (57.46%), Query Frame = 1
Query:  283 KNALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            +NALG   +  L  A   + ED    V++ RS V  VFCAGADLKER QMS +E+  +V  LR   + + A P PTIA +D             CDLR+   +A++GL ET   ++PGAGGTQRL +  G ++A
Sbjct:   57 RNALGNVFVSQLLEALAQLREDRQVRVLIFRSGVKGVFCAGADLKEREQMSEAEVGLFVQRLRGLMTEIAAFPAPTIAAMDGFALGGGLELALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALA 190          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: ECHD2_HUMAN (Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Homo sapiens GN=ECHDC2 PE=2 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 5.404e-23
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = 1
Query:  283 KNALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            +NALG   +  L      + ED    V++ RS V  VFCAGADLKER QMS +E+  +V  LR   + + A P PTIA +D             CDLR+   +A++GL ET   ++PGAGGTQRL +  G ++A
Sbjct:   53 RNALGNVFVSELLETLAQLREDRQVRVLLFRSGVKGVFCAGADLKEREQMSEAEVGVFVQRLRGLMNDIAAFPAPTIAAMDGFALGGGLELALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALA 186          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: CRT_CLOAB (3-hydroxybutyryl-CoA dehydratase OS=Clostridium acetobutylicum GN=crt PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.417e-15
Identity = 47/133 (35.34%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  286 NALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            NAL +D L+ + +    I  DS    V++  +  K F AGAD+ E ++M+  E   +       F  LE L  P IA ++             CD+RI    A  G PE GL I PG GGTQRLS++ G  +A
Sbjct:   26 NALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVAGADISEMKEMNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARFGQPEVGLGITPGFGGTQRLSRLVGMGMA 158          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: PAAF_ECOLI (Probable enoyl-CoA hydratase paaF OS=Escherichia coli (strain K12) GN=paaF PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.622e-13
Identity = 49/135 (36.30%), Postives = 72/135 (53.33%), Query Frame = 1
Query:  283 KNALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLR-STFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            +NAL   +L  L +  E  + D+S +V +I  +  + F AGADL E   M+  ++   +N  R   ++ L+A   P IA ++             CD+ + GE A  GLPE  L I+PGAGGTQRL +  GKS+A
Sbjct:   23 RNALNNALLMQLVNELEAAATDTSISVCVITGNA-RFFAAGADLNE---MAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAGENARFGLPEITLGIMPGAGGTQRLIRSVGKSLA 153          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: ECHM_RAT (Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus GN=Echs1 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.648e-13
Identity = 45/133 (33.83%), Postives = 64/133 (48.12%), Query Frame = 1
Query:  286 NALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            NAL   ++  L  A ET  ED +   +++     K F AGAD+KE +  +  +   Y     S +  +  +  P IA ++             CD+   GE A  G PE  L  IPGAGGTQRL++  GKS+A
Sbjct:   59 NALCNGLIEELNQALETFEEDPAVGAIVLTGG-EKAFAAGADIKEMQNRTFQDC--YSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLA 188          
The following BLAST results are available for this feature:
BLAST of FC920184 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
AUHM_MOUSE2.344e-2644.78Methylglutaconyl-CoA hydratase, mitochondrial OS=M... [more]
AUHM_HUMAN5.222e-2643.28Methylglutaconyl-CoA hydratase, mitochondrial OS=H... [more]
YNGF_BACSU7.541e-2545.86Putative enoyl-CoA hydratase/isomerase yngF OS=Bac... [more]
AUHM_DICDI1.680e-2445.38Methylglutaconyl-CoA hydratase, mitochondrial OS=D... [more]
ECHD2_MOUSE3.743e-2444.03Enoyl-CoA hydratase domain-containing protein 2, m... [more]
ECHD2_BOVIN1.857e-2342.54Enoyl-CoA hydratase domain-containing protein 2, m... [more]
ECHD2_HUMAN5.404e-2341.79Enoyl-CoA hydratase domain-containing protein 2, m... [more]
CRT_CLOAB5.417e-1535.343-hydroxybutyryl-CoA dehydratase OS=Clostridium ac... [more]
PAAF_ECOLI6.622e-1336.30Probable enoyl-CoA hydratase paaF OS=Escherichia c... [more]
ECHM_RAT8.648e-1333.83Enoyl-CoA hydratase, mitochondrial OS=Rattus norve... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005A12EF RVDevelop1 Citrus clementina cDNA clone C32005A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920184 ID=FC920184|Name=FC920184|organism=Citrus clementina|type=EST|length=685bp
ATCAATTTTTCGTCACAATGAGTGCTTTAACGAAGCTAACGAAAACACTT
GCACATCACTGCGTCAAAAAATCTAAAACCCATTGGTGCAAACCTGCGCA
GCCACTTTTAAATTTATTAATCTCTGAAAATATTGTTAACATCAACACTT
CTCAGTTTCATCAGTACCAAAGCCGTAGAACTCTCATTCTAGATTCCGCT
TCCTCCGAATCTGTCCAGCTTCAGCGAATCTCCGATTCTGATATCGGAAT
AATTGAGGTTAGTTTAAACAGACCTGCGGCAAAAAAATGCGCTTGGAACG
GATATGTTGAGAGGCTTAAAGCATGCATTTGAAACTATCAGTGAGGATTC
CTCTGCTAATGTTGTCATGATACGTAGCTCGGTTCCTAAAGTGTTCTGTG
CTGGAGCTGATTTGAAGGAACGCAGGCAAATGAGTCCATCTGAGATTCAT
TTTTATGTCAACACATTGCGATCTACATTCTCCTTCTTAGAGGCACTTCC
TATTCCAACCATTGCTGTTATTGATGGAGCAGCATTGGGTGGTGGACTTG
AAATGGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTG
GGCTTGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACA
GCGGCTTTCAAAGATAGNTGGAAAATCAGTAGCAA
back to top