FC920186

Overview
NameFC920186
Unique NameFC920186
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length690
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12599 contig Ccv1_Contig12599:46..734. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920186 vs. ExPASy Swiss-Prot
Match: ASPR_CUCPE (Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.198e-70
Identity = 128/180 (71.11%), Postives = 152/180 (84.44%), Query Frame = 2
Query:  125 STPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQ 664
            S  N GL R+GLKK K D  NR+AAR++SK+ E  + + RKY+ +GNLGES D DIVALKNY+DAQY+GEI IGTPPQ FTVIFDTGSSNLWV   +C FS+AC+FH++Y+S RSS+YKKNG SA I YGTGA+SGFFS D+VK+GDLVVK+Q FIEATREPSLTFL+AKFDG+LGLGFQ
Sbjct:   24 SASNDGLLRVGLKKIKLDPENRLAARVESKDAEILKAAFRKYNPKGNLGESSDTDIVALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWV-LCECLFSVACHFHARYKSSRSSSYKKNGTSASIRYGTGAVSGFFSYDNVKVGDLVVKEQVFIEATREPSLTFLVAKFDGLLGLGFQ 202          
BLAST of FC920186 vs. ExPASy Swiss-Prot
Match: ASPR1_ORYSJ (Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2)

HSP 1 Score: 258.455 bits (659), Expect = 2.497e-68
Identity = 129/178 (72.47%), Postives = 147/178 (82.58%), Query Frame = 2
Query:  140 GLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNL---GESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQ 664
            GL RI LKKR  D N+RVAARL  +EG       R+  LRG     G  G+ DIVALKNYM+AQYFGEIG+GTPPQ FTVIFDTGSSNLWVPS+KCYFSIAC+FHS+Y+SG+SSTY+KNGK A I YGTG+I+GFFSED V +GDLVVKDQEFIEAT+EP LTF++AKFDGILGLGFQ
Sbjct:   27 GLVRIALKKRPIDENSRVAARLSGEEGA------RRLGLRGANSLGGGGGEGDIVALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACFFHSRYKSGQSSTYQKNGKPAAIQYGTGSIAGFFSEDSVTVGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGFQ 198          
BLAST of FC920186 vs. ExPASy Swiss-Prot
Match: CYPR1_CYNCA (Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2)

HSP 1 Score: 241.891 bits (616), Expect = 2.419e-63
Identity = 119/169 (70.41%), Postives = 138/169 (81.66%), Query Frame = 2
Query:  158 LKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQ 664
            LKKRK ++ N       S +  + R    KY +RGN  +S D +++ALKNYMDAQYFGEIGIGTPPQ FTVIFDTGSSNLWVPSSKCYFS+AC FHSKYRS  S+TYKKNGKSA I YGTG+ISGFFS+D VK+GDL+VK+Q+FIEAT+EP +TFL AKFDGILGLGFQ
Sbjct:    1 LKKRKVNILNHPGEHAGSNDANARR----KYGVRGNFRDS-DGELIALKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACLFHSKYRSTDSTTYKKNGKSAAIQYGTGSISGFFSQDSVKLGDLLVKEQDFIEATKEPGITFLAAKFDGILGLGFQ 164          
BLAST of FC920186 vs. ExPASy Swiss-Prot
Match: ASPR_HORVU (Phytepsin OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.159e-63
Identity = 119/175 (68.00%), Postives = 137/175 (78.29%), Query Frame = 2
Query:  140 GLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQ 664
            GL RI LKKR  D N+RVA  L   E +   +          L    + DIVALKNYM+AQYFGEIG+GTPPQ FTVIFDTGSSNLWVPS+KCYFSIACY HS+Y++G SSTYKKNGK A I YGTG+I+G+FSED V +GDLVVKDQEFIEAT+EP +TFL+AKFDGILGLGF+
Sbjct:   29 GLVRIALKKRPIDRNSRVATGLSGGEEQPLLSGANP------LRSEEEGDIVALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYKAGASSTYKKNGKPAAIQYGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLGFK 197          
BLAST of FC920186 vs. ExPASy Swiss-Prot
Match: ASPRX_ORYSJ (Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 5.589e-52
Identity = 98/174 (56.32%), Postives = 129/174 (74.14%), Query Frame = 2
Query:  140 GLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGF 661
            G  R+ L K++ D  +  AA+L  +     +T             S D+D V L +Y++ QY+G IG+G+PPQNFTVIFDTGSSNLWVPS+KCYFSIACY HS+Y S +SS+YK +G++  I YG+GAISGFFS+D+V +GDLVVK+Q+FIEATRE S+TF++ KFDGILGLG+
Sbjct:   28 GFLRVNLNKKRLDKEDLTAAKLAQQGNRLLKTG------------SSDSDPVPLVDYLNTQYYGVIGLGSPPQNFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYNSKKSSSYKADGETCKITYGSGAISGFFSKDNVLVGDLVVKNQKFIEATRETSVTFIIGKFDGILGLGY 189          
BLAST of FC920186 vs. ExPASy Swiss-Prot
Match: CATD_CHICK (Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.168e-41
Identity = 79/124 (63.71%), Postives = 97/124 (78.23%), Query Frame = 2
Query:  299 LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYF-SIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQR 667
            LKNYMDAQY+GEIGIGTPPQ FTV+FDTGSSNLWVPS  C+   IAC  H KY + +SSTY +NG    IHYGTG++SGF S+D V +G+L +K+Q F EA ++P +TF+ AKFDGILG+ F R
Sbjct:   70 LKNYMDAQYYGEIGIGTPPQKFTVVFDTGSSNLWVPSVHCHLLDIACLLHHKYDASKSSTYVENGTEFAIHYGTGSLSGFLSQDTVTLGNLKIKNQIFGEAVKQPGITFIAAKFDGILGMAFPR 193          
BLAST of FC920186 vs. ExPASy Swiss-Prot
Match: CARP_NEUCR (Vacuolar protease A OS=Neurospora crassa GN=pep-4 PE=3 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 4.439e-41
Identity = 84/150 (56.00%), Postives = 104/150 (69.33%), Query Frame = 2
Query:  233 TSIRKYSLRGNLGESGDADI-----VALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQR 667
            T +R  S    + ++ DA +     V + N+M+AQYF EI IGTPPQ F V+ DTGSSNLWVPSS+C  SIACY H+KY S  SSTYKKNG S  I YG+G++SGF S+D + IGD+ + DQ F EAT EP L F   +FDGILGLG+ R
Sbjct:   50 TGLRTESHTQAMFKATDAQVSGNHPVPITNFMNAQYFSEITIGTPPQTFKVVLDTGSSNLWVPSSQCG-SIACYLHNKYESSESSTYKKNGTSFKIEYGSGSLSGFVSQDRMTIGDITINDQLFAEATSEPGLAFAFGRFDGILGLGYDR 198          
BLAST of FC920186 vs. ExPASy Swiss-Prot
Match: CATD_CANFA (Cathepsin D OS=Canis familiaris GN=CTSD PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.908e-40
Identity = 94/192 (48.96%), Postives = 118/192 (61.46%), Query Frame = 2
Query:  125 STPNGGLYRIGLKKRKFDLNNRVAARLDSK-EGESFRTSIRKYSLRGNLGESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKC-YFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKI---------GDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQR 667
            + P   L RI L   KF    R    L    E    +  I KY+ +G    +G      L+NYMDAQY+GEIGIGTPPQ FTV+FDTGSSNLWVPS  C    IAC+ H KY SG+SSTY KNG S DIHYG+G++SG+ S+D V +           + V+ Q F EAT++P +TF+ AKFDGILG+ + R
Sbjct:   15 AAPAAALVRIPL--HKFTSVRRTMTELGGPVEDLIAKGPISKYA-QGAPAVTGGPIPEMLRNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSALSGLAGIKVERQTFGEATKQPGITFIAAKFDGILGMAYPR 203          
BLAST of FC920186 vs. ExPASy Swiss-Prot
Match: CATD_RAT (Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 6.410e-40
Identity = 92/184 (50.00%), Postives = 119/184 (64.67%), Query Frame = 2
Query:  134 NGGLYRIGLKKRKFDLNNRVAARLD-SKEGESFRTSIRKYSLRGNLGESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKC-YFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKI------GDLVVKDQEFIEATREPSLTFLLAKFDGILGLGF 661
            +  L RI L  RKF    R    +  S E    +  I KYS++ +   + +     LKNY+DAQY+GEIGIGTPPQ FTV+FDTGSSNLWVPS  C    IAC+ H KY S +SSTY KNG S DIHYG+G++SG+ S+D V +      G + V+ Q F EAT++P + F+ AKFDGILG+G+
Sbjct:   18 SSALIRIPL--RKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSS-PRTKEPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDLGGIKVEKQIFGEATKQPGVVFIAAKFDGILGMGY 198          
BLAST of FC920186 vs. ExPASy Swiss-Prot
Match: CATD_CHIHA (Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2)

HSP 1 Score: 163.31 bits (412), Expect = 1.093e-39
Identity = 89/188 (47.34%), Postives = 114/188 (60.64%), Query Frame = 2
Query:  134 NGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLG--ESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKC-YFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQRFLFESCA 688
            N  L RI LKK +      +  +L      +       +SL+ NL    S       LKNY+DAQY+GEIG+GTPPQ FTV+FDTGSSNLWVPS  C    IAC  H KY SG+SSTY KNG +  I YG+G++SG+ S+D   IGDL +  Q F EA ++P + F+ AKFDGILG+ + R   +  A
Sbjct:   16 NDALVRIPLKKFR-----SIRRQLTDSGKRAEELLADHHSLKYNLSFPASNAPTPETLKNYLDAQYYGEIGLGTPPQPFTVVFDTGSSNLWVPSIHCSLLDIACLLHHKYNSGKSSTYVKNGTAFAIQYGSGSLSGYLSQDTCTIGDLAIDSQLFGEAIKQPGVAFIAAKFDGILGMAYPRISVDGVA 198          
The following BLAST results are available for this feature:
BLAST of FC920186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 101
Match NameE-valueIdentityDescription
ASPR_CUCPE1.198e-7071.11Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1[more]
ASPR1_ORYSJ2.497e-6872.47Aspartic proteinase oryzasin-1 OS=Oryza sativa sub... [more]
CYPR1_CYNCA2.419e-6370.41Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO... [more]
ASPR_HORVU3.159e-6368.00Phytepsin OS=Hordeum vulgare PE=1 SV=1[more]
ASPRX_ORYSJ5.589e-5256.32Aspartic proteinase OS=Oryza sativa subsp. japonic... [more]
CATD_CHICK1.168e-4163.71Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1[more]
CARP_NEUCR4.439e-4156.00Vacuolar protease A OS=Neurospora crassa GN=pep-4 ... [more]
CATD_CANFA4.908e-4048.96Cathepsin D OS=Canis familiaris GN=CTSD PE=2 SV=1[more]
CATD_RAT6.410e-4050.00Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1[more]
CATD_CHIHA1.093e-3947.34Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005B02EF RVDevelop1 Citrus clementina cDNA clone C32005B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920186 ID=FC920186|Name=FC920186|organism=Citrus clementina|type=EST|length=690bp
GTCTGCTCCAAGCATTTCTCTGTCTCGATCATCGAAAGAGACTTTACTTG
TCAACATGGGAACGGTATTCAAATCTATTACAGCCGGTTTCTTCCTTTGT
TTGCTTCTGTTTCCTGTGGTGTTCTCGACACCAAACGGTGGGTTATACAG
AATCGGACTTAAAAAGAGGAAGTTTGACCTGAACAACAGAGTGGCTGCCC
GCCTTGACTCCAAGGAAGGAGAGTCATTCAGAACTTCTATCAGAAAATAT
TCTCTTCGTGGAAACTTAGGAGAGTCAGGGGATGCTGATATTGTTGCGCT
GAAGAACTACATGGATGCTCAGTACTTTGGTGAGATTGGTATTGGCACAC
CCCCGCAAAATTTCACTGTGATATTTGACACTGGTAGTTCAAATTTGTGG
GTGCCCTCTTCTAAGTGTTATTTCTCGATTGCATGCTATTTCCATTCCAA
GTACAGGTCAGGCCGCTCAAGTACCTACAAGAAGAATGGTAAATCGGCTG
ATATCCATTATGGAACTGGAGCTATTTCTGGTTTTTTTAGCGAAGACCAT
GTCAAAATCGGTGATCTTGTGGTCAAAGATCAGGAATTTATTGAGGCAAC
TAGGGAGCCCAGCCTCACTTTCTTGCTGGCCAAGTTTGATGGCATACTTG
GACTTGGCTTCCAGAGATTTCTGTTTGAAAGCTGTGCCCG
back to top