FC920187

Overview
NameFC920187
Unique NameFC920187
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length678
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14125 contig Ccv1_Contig14125:40..717. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920187 vs. ExPASy Swiss-Prot
Match: UXS1_XENTR (UDP-glucuronic acid decarboxylase 1 OS=Xenopus tropicalis GN=uxs1 PE=2 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 2.411e-68
Identity = 129/205 (62.93%), Postives = 153/205 (74.63%), Query Frame = 2
Query:   68 MAQEISNGNHNSASKPPPTPSPLRFSKFF--QSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLDMLGLAKRVGARILLTSTSKVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVADTLMFDYHLQHGIEIRIARI 676
            + ++I N   +   K PP        KF   +   RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTL+MLGLAKRVGAR+LL STS+VYGDP VHPQ E YWG+VNPIG R+CYDEGKRVA+T+ + Y  Q G+E+R+ARI
Sbjct:   63 LREKIQNLERSFTQKYPPV-------KFLSEKDRKRILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEEYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARI 259          
BLAST of FC920187 vs. ExPASy Swiss-Prot
Match: UXS1_RAT (UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.149e-68
Identity = 134/226 (59.29%), Postives = 163/226 (72.12%), Query Frame = 2
Query:    5 IRKSGFFSIVCKLSVI*EV*GMAQEISNGNHNSASKPPPTPSPLRFSKFF--QSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLDMLGLAKRVGARILLTSTSKVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVADTLMFDYHLQHGIEIRIARI 676
            I+++G   I  K+  I E   + ++I +   +   K PP        KF   +   RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTL+MLGLAKRVGAR+LL STS+VYGDP VHPQ E YWG+VNPIG R+CYDEGKRVA+T+ + Y  Q G+E+R+ARI
Sbjct:   43 IQENGELKIESKIEEIIEP--LREKIRDLEKSFTQKYPPV-------KFLSEKDRKRILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARI 258          
BLAST of FC920187 vs. ExPASy Swiss-Prot
Match: UXS1_MOUSE (UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=2 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.149e-68
Identity = 134/226 (59.29%), Postives = 163/226 (72.12%), Query Frame = 2
Query:    5 IRKSGFFSIVCKLSVI*EV*GMAQEISNGNHNSASKPPPTPSPLRFSKFF--QSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLDMLGLAKRVGARILLTSTSKVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVADTLMFDYHLQHGIEIRIARI 676
            I+++G   I  K+  I E   + ++I +   +   K PP        KF   +   RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTL+MLGLAKRVGAR+LL STS+VYGDP VHPQ E YWG+VNPIG R+CYDEGKRVA+T+ + Y  Q G+E+R+ARI
Sbjct:   43 IQENGELKIESKIEEIVEP--LREKIRDLEKSFTQKYPPV-------KFLSEKDRKRILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARI 258          
BLAST of FC920187 vs. ExPASy Swiss-Prot
Match: UXS1_PONAB (UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 7.015e-68
Identity = 133/226 (58.85%), Postives = 163/226 (72.12%), Query Frame = 2
Query:    5 IRKSGFFSIVCKLSVI*EV*GMAQEISNGNHNSASKPPPTPSPLRFSKFF--QSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLDMLGLAKRVGARILLTSTSKVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVADTLMFDYHLQHGIEIRIARI 676
            I+++G   I  K+  + E   + ++I +   +   K PP        KF   +   RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTL+MLGLAKRVGAR+LL STS+VYGDP VHPQ E YWG+VNPIG R+CYDEGKRVA+T+ + Y  Q G+E+R+ARI
Sbjct:   43 IQENGELKIESKIEEMVEP--LREKIRDLEKSFTQKYPPV-------KFLSEKDRKRILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARI 258          
BLAST of FC920187 vs. ExPASy Swiss-Prot
Match: UXS1_HUMAN (UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 7.015e-68
Identity = 133/226 (58.85%), Postives = 163/226 (72.12%), Query Frame = 2
Query:    5 IRKSGFFSIVCKLSVI*EV*GMAQEISNGNHNSASKPPPTPSPLRFSKFF--QSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLDMLGLAKRVGARILLTSTSKVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVADTLMFDYHLQHGIEIRIARI 676
            I+++G   I  K+  + E   + ++I +   +   K PP        KF   +   RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTL+MLGLAKRVGAR+LL STS+VYGDP VHPQ E YWG+VNPIG R+CYDEGKRVA+T+ + Y  Q G+E+R+ARI
Sbjct:   43 IQENGELKIESKIEEMVEP--LREKIRDLEKSFTQKYPPV-------KFLSEKDRKRILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARI 258          
BLAST of FC920187 vs. ExPASy Swiss-Prot
Match: UXS1_DANRE (UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2)

HSP 1 Score: 256.914 bits (655), Expect = 7.015e-68
Identity = 122/170 (71.76%), Postives = 142/170 (83.53%), Query Frame = 2
Query:  167 RILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLDMLGLAKRVGARILLTSTSKVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVADTLMFDYHLQHGIEIRIARI 676
            RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTL+MLGLAKRVGAR+LL STS+VYGDP VHPQ+E YWG+VNPIG R+CYDEGKRVA+T+ + Y  Q G+E+R+ARI
Sbjct:   88 RILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQNEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARI 256          
BLAST of FC920187 vs. ExPASy Swiss-Prot
Match: GALE_METJA (Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii GN=MJ0211 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.937e-17
Identity = 63/176 (35.80%), Postives = 96/176 (54.55%), Query Frame = 2
Query:  170 ILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIE------VDQIYHLACPASPIFYKYNPVKTIKTNVIGTLDMLGLAKR--VGARILLTSTSKVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVADTLMFDYHLQHGIEIRIAR 673
            ILVTGGAGFIGSH+VDKL+EN   +VI++DN  TG+K+N+     +P+ E +  D+ +  L E      V+ + H A   +      NPV     NV+GT+++L + ++  +   +  +S   VYG+P   P DE++     PI   S Y   K V +  +  Y+  +GIE  I R
Sbjct:    2 ILVTGGAGFIGSHIVDKLIEN-NYDVIILDNLTTGNKNNI-----NPKAEFVNADIRDKDLDEKINFKDVEVVIHQAAQINVRNSVENPVYDGDINVLGTINILEMMRKYDIDKIVFASSGGAVYGEPNYLPVDENH-----PINPLSPYGLSKYVGEEYIKLYNRLYGIEYAILR 166          
BLAST of FC920187 vs. ExPASy Swiss-Prot
Match: ACBB_ACTS5 (dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (strain 50/110) GN=acbB PE=3 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.618e-14
Identity = 61/184 (33.15%), Postives = 86/184 (46.74%), Query Frame = 2
Query:  164 MRILVTGGAGFIGSHLVDKLMENE------KNEVIVVDNY-FTGSKDNLRKWIGHPRFELIRHDVTEPLLIE-----VDQIYHLACPASPIFYKYNPVKTIKTNVIGTLDMLGLAKR--VGARILLTSTSKVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVADTLMFDYHLQHGIEIRIAR 673
            M+ILVTGGAGFIGSH V  L+  +        +V VVD   + G+  NL +    PRF  +R D+ +  LIE      D + H A               + +N++GT  +L  A R  +G R L  ST +VYG       D   W   +P+   S Y   K  +D L   YH  HG+++ + R
Sbjct:    1 MKILVTGGAGFIGSHFVTSLISGDIATPQPVTQVTVVDKLGYGGNLRNLAEASADPRFSFVRGDICDEGLIEGLMARHDTVAHFAAETHVDRSVVASGPFVASNLVGTQVLLDAALRHHIG-RFLHVSTDEVYGS-----IDTGSWAEGHPLAPNSPYAASKAGSDLLALAYHQTHGMDVVVTR 178          
BLAST of FC920187 vs. ExPASy Swiss-Prot
Match: STRE_STRGR (dTDP-glucose 4,6-dehydratase OS=Streptomyces griseus GN=strE PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.420e-14
Identity = 56/177 (31.64%), Postives = 82/177 (46.33%), Query Frame = 2
Query:  170 ILVTGGAGFIGSHLVDKLMENEKNEVIVVDNY----FTGSKDNLRKWIGHPRFELIRHDVTEP----LLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLDMLGLAKRVG-ARILLTSTSKVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVADTLMFDYHLQHGIEIRIAR 673
            +LVTG AGFIGS  V  L+       +VV       + G+ DNL    GHPR+   R D+ +     ++   DQ+ HLA  +       +    ++TNV GT  +L  A R G A  +  ST +VYG       +   W    P+   S Y   K   D L   +H+ HG+++R+ R
Sbjct:    5 LLVTGAAGFIGSQYVRTLLGPGGPPDVVVTALDALTYAGNPDNLAAVRGHPRYRFERGDICDAPGRRVMAGQDQVVHLAAESHVDRSLLDASVFVRTNVHGTQTLLDAATRHGVASFVQVSTDEVYGS-----LEHGSWTEDEPLRPNSPYSASKASGDLLALAHHVSHGLDVRVTR 176          
BLAST of FC920187 vs. ExPASy Swiss-Prot
Match: YFNG_BACSU (Putative sugar dehydratase/epimerase yfnG OS=Bacillus subtilis GN=yfnG PE=3 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.876e-12
Identity = 51/183 (27.87%), Postives = 89/183 (48.63%), Query Frame = 2
Query:  152 FQSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIE-------VDQIYHLACPASPIFYKYNPVKTIKTNVIGTLDMLGLAKR--VGARILLTSTSKVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVADTLMFDYHLQHGIEIRIAR 673
            F  N  + VTG  G +GS+LV +L+E   N   +V ++   S  NL +     +  ++R  + +  +IE       +D ++HLA  A       NP+ T + N++GT ++L   ++  +  R+++ S+ K YGD    P DE+      P+  +  YD  K  AD +   Y   +G+ + I R
Sbjct:    3 FWKNKNVFVTGCTGLLGSYLVKELIEQGANVTGLVRDHVPQS--NLYQGEHIKKMNIVRGSLEDLAVIERALGEYEIDTVFHLAAQAIVGVANRNPISTFEANILGTWNILEACRKHPLIKRVIVASSDKAYGDQENLPYDENM-----PLQGKHPYDVSKSCADLISHTYFHTYGLPVCITR 178          
The following BLAST results are available for this feature:
BLAST of FC920187 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
UXS1_XENTR2.411e-6862.93UDP-glucuronic acid decarboxylase 1 OS=Xenopus tro... [more]
UXS1_RAT3.149e-6859.29UDP-glucuronic acid decarboxylase 1 OS=Rattus norv... [more]
UXS1_MOUSE3.149e-6859.29UDP-glucuronic acid decarboxylase 1 OS=Mus musculu... [more]
UXS1_PONAB7.015e-6858.85UDP-glucuronic acid decarboxylase 1 OS=Pongo abeli... [more]
UXS1_HUMAN7.015e-6858.85UDP-glucuronic acid decarboxylase 1 OS=Homo sapien... [more]
UXS1_DANRE7.015e-6871.76UDP-glucuronic acid decarboxylase 1 OS=Danio rerio... [more]
GALE_METJA1.937e-1735.80Putative UDP-glucose 4-epimerase OS=Methanocaldoco... [more]
ACBB_ACTS52.618e-1433.15dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (... [more]
STRE_STRGR3.420e-1431.64dTDP-glucose 4,6-dehydratase OS=Streptomyces grise... [more]
YFNG_BACSU1.876e-1227.87Putative sugar dehydratase/epimerase yfnG OS=Bacil... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005B03EF RVDevelop1 Citrus clementina cDNA clone C32005B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920187 ID=FC920187|Name=FC920187|organism=Citrus clementina|type=EST|length=678bp
GGGAATAAGAAAATCTGGGTTTTTCAGTATTGTGTGTAAGCTTTCAGTGA
TTTAAGAAGTTTGAGGAATGGCTCAGGAAATTTCAAATGGAAATCACAAC
TCTGCTTCTAAACCACCTCCAACTCCGTCCCCTTTGAGATTCTCCAAATT
TTTTCAGTCCAACATGAGGATTCTGGTTACTGGAGGAGCTGGATTTATCG
GCTCTCACCTTGTGGACAAGTTGATGGAAAATGAAAAGAACGAGGTGATT
GTAGTTGATAACTACTTCACTGGCTCAAAGGATAACCTAAGGAAATGGAT
TGGTCACCCAAGATTTGAGCTTATTCGTCATGATGTGACTGAGCCATTGT
TGATCGAGGTTGATCAAATCTATCACCTTGCTTGTCCTGCCTCCCCAATC
TTCTACAAATACAACCCTGTAAAGACTATAAAGACAAATGTGATTGGTAC
ATTGGACATGCTGGGGCTTGCCAAGCGAGTCGGAGCTAGGATTTTGCTTA
CATCAACTTCAAAGGTTTACGGAGATCCTCTTGTGCATCCCCAGGATGAG
AGCTATTGGGGAAATGTGAACCCAATTGGAGTCAGGAGTTGCTATGATGA
GGGAAAAAGAGTTGCAGACACTTTGATGTTTGACTACCATCTGCAGCATG
GGATTGAGATAAGGATTGCTAGGATTTT
back to top